C 00K0 0 ` p 0h0$`0+4 P2 5h q1 5000 hJ000`\% R = S 04, 03030 4040 50OJ0 " " 20 5 X
p u (K T
-L,M @< 408 A 11 p PL U, 800`T 0 W40`e BE> C 000K0 0 0 0` 0 ^ P 0 0 J<00 S p8 P8 Y80o P 0 (K
-L M R @q 0 #
R (P/oA Q" R` e ` X P U
$ <40 K + P 00t R p0T P
U
00 S
p p0! Q P S 000 00 S 0 S U,0(0#1000# S0 X00' 00E 0 ,e Z (0 U$( PP0 X 0 Fb 0 e Z 0 P Pn
0 X 0 Ib0 e 0 QS P= S ,0
(0 P
P 0
(0
S 50ó 5= S ,0 00 00(0 = S # P
h ,0
5<
0!00(01 T 000000\4 S
(0
0 S 0 H 0 S?
0 0 0 0 7 `P u/ 50 5= S
0 0 0C^ N~ p X$E>
(0 S N ` ܁(01(0 0 R
` ` ` (Kȟ] @^ְ^^^2^Q^
- @ ` <1L Pq P
00 P= = S V P 0
t0 S
W Q ]a wR$%0, RL1j hj P
jT K j (0 :(0
-L$M p` @= S
= S
ll4K%+ V00 V80 00 P,K`)<0 04 J+ P
8KW P
R V 0 0
< Vb P P R4 + V
T0 S l0 S
%W 0 V
:b P P c= S
0080CN P P (K贈]^ N
0-@` L( #
|
Q `0 00P05/ T 0- /
-L M|@p #K0 P80 0` ` ( 0 00 Y S *9
0 0 0 P9 ;909
0 0 0 P9 ;900 X
80 S@@ 0 S
♨ Z
`0 } 00 p#K1/ a R 0 0 X }
W `0
0
0 0(Ko /
(K
-LM00 |H0 0 @0 * 60 S #K
K* Q P t #K R 0o K0 D0 ) Q Pf D0 SD c
@08 =p0 0 0|0 `0(0@0t0 *#KcK=CH0 K#K R K0 0 0 0 pp0 S0 0L0 D0 `hKcK` p#K V0cK 0(K#K R0G KP0 0 N0 P 0K= 0 D&K S R4
K#K ԅK S R*
0
q L0 0H00#K X0 #K pP 0l0 |0 S
cK#H0 ` 0# 0 0c 0l0 0 S
@0
) xp= C00` 0f` S`1 V
(K X0p(K p X0 pp Wp L 0"0 0 0 p >0 P `p p 0 0%KK# R0 0 p W
L H pP} u |'KH0 0L0 0 0 'K1/ p u We H0<00 0@0 0 ) # pK R0 0 5p 0l0 WK t0 Sz(8 8\0 I8X0 0(C8d `0 K%K S Rj
9 1 0 0 0 0 b pPV
# p0 Sp
#K 0H #K#00 `J`p 0x ȟ` p0 0 #K 0ab pl0p 0D0 0#K H0@ (K !
0- 0L@ PPk| P 0 K0hO0
p-L M@|P `Ea9 S ʸ; S
` ( 0 0 P Q
0 SL0L0 :z P t |` |P 0 ,z Kpdh`- /- /- /- /- /
-LdM|@t 0X ) U T P
* U T p# *,0K\0 0\ 8`0"\ @ T
*$K &KK$K R0 R&K 0 px PK
0%K#K0 P 0K K
+$K S R :0P D08UP@50LPP850p p0 p d00 c P @1d0 &K R0 K
@K+$K S R \0 PX 0 00$KJ" %K R 0 K
+$K S R *p0Dpp@5pL0p\0 PX 0 000 080K040K0$K8p J P p <0 Pb T U
@0 d0 M pP < c 0 K#K 0 0 K R &F0 P P C 0 ' _ m 1PP00p 0 $K Y P
mR T0`F `%K R0%K 0`p |0 0 ` %K1/ l|04 K 0 P %K 01/ P N `@0 U Z $K ?K R0 K06 #K R0 3ҡ0ã3¡ 303 P P8 m @Q h j_
(K \
-LM @`p |P`0 0 0 01/ P# P * W V $K
-L MP p|@``9 S2
9 S# (0 *0 00 S 0( 0 0 0 P 0 0)9+ 0 00 0 0
`0 00 0 8/ 9 ?o2 09 S& 0 Q 0
!0
h0 S
!0
Q#`h@ PЁA $$ A `uu 4v$K]^د^
-L M0c0@`, (0 0 @04/KШXCTݲ^`FT0@-`@ ,0@0 S00000
@@PD @b T S l 0h 0d 0 P 0
S
P
00 $0 P 0 005^^C^^ ^
-@ `P00LP 0 ; b ;0`0,0@09#60
-L0[=0[ S < [. R S # Q P
Q P0 0; [. R P
(K
-LTM@1 ` 0P0 `0X 0P0Yp1 \0 ^1 @ T0 ]|04 K p 0 @ #1/
X ?K&KHP0 T K "#K R0$KK&K R0&K$KD0 S
$KK D0 1 0$KD0@ U
80K0 0@D @00000 0 0 @P 0 0 08 S
X0PEP00P0 P0 \ ] T] (K耼
-LM `0pp0 0|@p t0 0`0 0 0l0 `0,P 0P0 0h0t 0h0T P8 90
`0(0
`00C S P6 p0 0H0K00 0 0 PH0
S080p0 0 S P s S080`000 0 000 R 00 S00 00000 0\0 `0D00C0 `0 S \ P
Њ? S P : 0` 0 d ` d { 00
` PK` P
@00 `0
0 l00C 0 ?*K܊Kl ? +K8l0 0 0|0 x0 h0 l08#80 `0 R 640
`0 P P
0` PK0 0? P
\0 S d0 0 S|0 0 |0 \0 Sd \0d0 |0 P00d0ഐ Y
60 S
d
P %` 0Cd0 0i )U \0 S'
0 S
0 S00000 0c S 0` S \ Q x|0|0 S 0hx0 x 0 0\0 0 S'
R R 0 E@ PP 0 S0
R
d0`x 800h0 0\0 0K Sdo
m `0d h0 0 `0d Rh M0 S 0`0\00 00 CP P
a0 S
`0 SA 08S= 0 S6
9 S3
t R P \0 S
jK+K `p 7l0h0 `0\0 `0` S 000cT T0 x0T0h0 S0h0 0h lP l0X0 `0 S
0p 00 9P 0` S* Y X |" 00 S0 00 0 P 0` R 00 S
l0 c`0 \ : `0 S7 0 SQ
K`000T0cT%K$K# Q P DCLp L0K DK` D PT t L`R P 9 L
|0t si0 t 剄 P?
BPB 0` R 00 S
t Q P+ %KK#K# Q PP-
L0K <K` D PP& %KK#K# Q P BLp L0K 4K` D P p0L 0 00 P L0p 0 0 SL (K#^.^
-L,M@0 `0|@ ,p0 `<0 0P * Q P
00 S0 00 00 040K000K 0 ? Pp 0@080 p W
Spppppⴠ
0g Z 0p
p W0 p
8 Rppppp0g D0 g8D0< R
R <0 > P<0 p Zpő
Z0őpɑ r80 S0 0
;84 P 0 PP0 0 P
?
S R
*`@
1/ (K%]?^K^
-L4M @ R `p0O `0 |P ,0刀H0 0H
q@K0 ?1/ P8 ?* Q ! 0 0 0*a @ 0 0 0@ D 0 @ 00 H 7@ `P0
9 0 p|@ 0 0 00900
0 00 R d0X09 08C890 00 0`0 00`06/ `Pk DK 0I 3K00H K D0 0080 04KP00 S0>0K020K`01`K=`K 00 01/ `PC ?* Q ! 0 0 0*YY H0 DK0 ?/H G `P* `0 00 09/ `P 0 c
H0 0T 0 `0 c V J 9 0C8C890 00 0 0 90 00 08 (K h]
-LMp|`|P V
p0 S
8 8 S 9 S
B@H # P
10 S@: 1@0 S4 @0 T @P, 0 9 0C8C890 00 09 0C8C890 00 0`0 00 - 01/ 0 q 8 $K
-L\M0 pd0 `0 P A P Pe Y U@ @ ` a t 0`PKX0 L KT0KL0 H`
^@
-L Y P00 @ Y@
- `L@ T)
3 S&
0 S
L 0 SP
٭ PPh 六 U 0 P 0 S 3 ( 2 3 0330C3m E^
-L` P
P%
p#
P P @ aM 0 03` 03 3 S 8 < D 3
03 ; T
7
0- @ L P
:M 0 00
-@L ` T&
3 S
~ @P
P U
Ӭ 3 0C3 0 0 0 A3
03 圭 T 廬 8 D 0 S 4 岬 0 ( X00CX0 ? 4
p- `L M PK% @ T
P0P 0 Ҭ P
P @@' P Kp
- @LP`L | 8 Ử 巬 Q 0 0 Kh
-LMP Q e6 K 0 s / 0@-800 0 CA T <01 D A@ _@! R
U T !0 0
-L M80P ` L #A R 0<0aE Dp@Ap!1ȟ R
Y X
V00
Q @P
!00 R!@A@ 0w# PQ V@`
T000 T00C00 S 0 S R (K+
-L M#K0 P 0`80 0@p>
p ၣ`F@80 X/ 0 s&
#K {7 P 40 #00b P #K C P
3@03303 3 03 0 X
T p#K* 0#K0 Wp p 0
`F@ 0 S
#K* 0#K80 X 弫 n 0 X
0
#K ,7 @P @#K @P 姫 p: ` Y
303 3 03 @
03 0 ! 0 0 0 S40 #00 P 77 ! {
K 1 Z
3
P ]K p 87 ` _ ]
p 0 3 03ᨒ3@03 @ po (KN^Z^
-L M*0P
` p00
0hAc80 Y X 0E @c8 0(A0 UP0
Y$
cA V 0 &lG p/o V D0" : P@
Y
E P< c\ U80080 0 0 "| 0 00 S
d 㣪 X 0 PP ⥪ @1@A SH H0L 00L0@ Cު (Kb^^]+ -P /
0-LM\0\@ T LP\ @Av 0 0,0@ @0 0X NK0+^
-L5 P
K hJ
-LM P @ 4 00
v#zf 0-K- p$c vK#zf
Ԁ ` p# P0 [4 00v#zf-K V0"Ơʌ C !1 ,? R0
< Y9K4K
0 h0 |0Kd 00 0 0-K -K-K
@0D̠K0 00 Y
|0K Xo
3@
-K P00 0 P 0 S -K R0` -K 5 -K* 0 P-K@
3 #
Y
0帀 0 0 003<0 A280 40#2>D0 B2@0 H0 VZ @ A T8
0L0 #K P0P$K P R0P U( #K S RP$K S R040pq0 S P P0 EI 00 P0 B P R R OL@`cK R` @ P p?#KK P0
< P I @ P Y
, 庨 ( X 0iX0(Ko (K+ 4
0-LM0 @ sM
' PI (埨 H0 SL L L0H ٨ 唨 咨 P U
3
03 Ȩ 0 0 0 (0, #6 4 x 嵨 0 . 宨 #A R D @ 8 < B . X K0hBK0, ^
-AL J @A T 刨 `Z HP U
T} 8 #A R 0 ` p, D R- @0 0 S
` Y X \
Q 00 P
` B @<0! Y 00 X0 S
` p# V0 ` P
9 F V
U
@ @U +,
-L0#600 1<0
00M 0 ԡK 忥 0
0 0 1 }< * !0 0 K %K1/ P 80H p0P0 41 ˎ8 0# R P &L . 0 L p00 W L0 ~ L0# R
8 0 S
0 奎0 $2 孥 t 4 L0 姥 L0 0X0 唎 00 0D 4P0 PeE3 P0 U^80 (K\^[
-L4MX 20 P4 bP5@0 3@C3 U@0sY
!#K܃K0 0" 0 0 |"K P KK 0 $K R0"fjD 1
00M%K0L
T 00 0 L0C1 X *< T0 0 KH0 0. #H # 0 T0& x1 |1 L 1 DDa Ӥ 0 ! 00 00C S 0A X00 /
ä 1 0 <0 儉< 00 0(0 S, , ( ,0 80 S< < <08 0@ 3@ t0 0 @0 R 04@0 @@040
X 00 0 000@0040@00 @@0 Ȥ (K [
-L,M p @`&10P@0 #K U)
00K 0`#K 0P T 0% @@0 T 00 S
TT 7U0 K00 TKPc
(K踏]f^
- P`pL$M@0K T
0 0@ 0
8 80 00` p@c(K
0-(0L P S"
@ (0 S
R*2:8 R<<8< ( R,,, ( K0h3 0 00 0 /
-L$M pD@@p P ` 0p q@0 SH0
@ K0 > P @00@0 @00 SK
0 4 <` R 1 8 , 4 0 ( $ Q H \ 4 - H \
Q
\
P ( Q H0 堣 800 X *@ D a P004
R
0 R4 @0H0 ʣ < K5/ P Kď]
0 -LM K0" K N
0- @L e 0 00K0h衣 Q $
0-LM @P P 0 S 0C0K0h芣 E ,0
0,0 偣 P 0p 80 S< < <08 ,0
( l j l) @ K0hg=( t^
R0-L @P
W U
S T
K0h< 0
-L,Mp@ 0P$` @PD0 H
# #K& P 0H P @0 a" 0K#20#H0 <0@ pcD0p U2 H0 U 00 S% 1 s"
K0 0 03) pL !
̅0 L 40& Å P
0 0 H X 2 * 0P P P 0 0 H~ (K^
-LM@ `p % P @x 0! S S
,0 T 40# 00 S X
0 ( p
J PHtti h @ T
# W V
8@D堢 @ <00 P @( R Q(
# W V/
8,0
0,00 0 0 0,0 z 5 0 00s . ,0
,00,0 P80,c8 P<0<< ^ 0 [ ]( @ Z< $K蜚S$ ( ď]^P 0>0>0 0 00 0, ( S
0 Q /ᔼ, x
-LM Q, ( ( 0K :_ P K , 0 *`,
- pP @L Tf
+ 0 P@ 0 $Kkꌵ[
-Lć 0 K hꌵ[ P / Q
R0-L P@
T
K0h
- @P 0Lp 000 U
p `P 00a S0500
U$`
` 000
-L M0 pQ `0 H@ r@@
T 0 P U 0 0 PP
0 T 033 0 P 0G+ P 0 P0 K- 2 Pp0
X 0 T
- 0 0D a P(K4 ^
0- PPL
D@000 1 0 R000
+ 0 04
-LM`00 0Pp 0 @ H3* 0 0 S0 00 0 0
߃ pP
&2 P p
t 30 p `d Ơ V
, 303 , 8 V
0
(K蟵^
-L M@0pH 0 P `) 3 00 Q
ᕃ `P
, Ƞ 3
V 3 C03 82 P `,
/ `( p 0 S
R, 3
3p03 +, ph 墠 W
(0, #63
( 3C03 0 傉 (K ^
-L MD`0 p000 P S$30 !h2l200h2l2 P3 040 @ T*
3 S
@P#
3
03000 Y
0 e 0" 0 0 0p 2 Q 0\" 0 0d ' 4 W 0 ` ) @P 0 >0001 P_
I/ 0 1x0 0x0 M@ P 0 .
˟ Y*
3
U
P ? 0 0 6 <嶟 + , Z
1 3 3 奟 l+ 3C03 Z Y
۟
W
0D c V
0 000Y Z
U
Z (K4 ^^ɵ^
-PpLCM `@ K 0l] K K K 1 L- 0 p P0Q ,= 0 S
PE 0@
K A :N@` @ 0 @ t K P
1 S08 4 C @4 \K[ \ K K0 K (
[ R $ R 1
Kc P
00
0 0 00
P.
+000 H$p X WP P
U [ R \+L P & Pe%P QP1. b P l2. B R K P 0Ȑ X` c
婞 0 K D `K0 UL 0B?o2 0 SE
X
1 S
0 S
#
X
1 办 1# R L* 4
Ş
U @0 S{
B u Wn
0" A?K j A?K 1/ XW 060 0Pe 0P 0 P0`yH01 10 U0B SlK
0 ᖄ P 0 Z
! R 01- 010 U(
Y%
Q" " * a 01 e' 0 Q[0Ã Q 0 0 <P, K!@ rf QH K @P
# T7 0/ 0 `3 S
0[ S000 8
0 S 0 H@ P
K (|V `0[ S$
0 S! 0@0K,0K P# K K T @P0@嵝 ) 3A0300C0 @0 &0000 S0 0Ã0 0 K Kz $P Uy
0 ` V
B 0 K @l K04/ P @S=/ PP
, Luv 0 0000 00" @ L RlK 0 K 1/ R01 0,K1@ H 0J s `161 0 V9 0 V
3
Y %0 S X? )
) h 0 Y0030300 0 0[ 1 Q 0
Z& 1 0 60, K1@`0[ S00#100 V0K
3!h20h2m 1Hp K!l20l2 7# 0` 0000 0 c000L 00 ` 0 0 0K 00K 0 0 :/ P
# P 3 0/ Q p@
@P-
K W X `
塜 0 P 坜 囜 b( ڜ 03 X
0D c P
Km Vk
Vh
`0[ S4 B00000
000 1 R > P3 S
0[ S000
0 Hp 0P7 3
) 3 K 030l00+ 0$ 0K0H 0 0K K @P0 vp0
0
ᤃ3
3030 K Ko @0 `0K# 3
3 03
H 000 ( G a W (K 9Ե^4 ] ^^^0]^ ^
-L M, K` pO
P P M S,@ U ,0@0 S c( % P
' Pj V *( K P,@ 0
V:@ 0 U
L , 4 峛 ,@@ U
, K^
- @P`L Kh
Q-L ` pP Wpp U *0
@P
U
Z T 0 T 00 0 `
-@pH`^NLP @ .0 @ x
-L . M. K . .
R0-L P@
0D0 D ` D K0hZ
-L M@ U 0 1K
-@0ML040 0 ;
F0 K 蘼@^0 0 BG0 0 R(',' @ 0 N@ 0 `p P P
|| J 0@ @ $ U ?3 P0 0 0 0 P
J K ]˶^^
-LMP1 p `H10 PP0 @c0c K Ϙ 1 } p#K T0, 0 }$ P
3
03 0 0 0 尘 $ V Pp$ 4 Z
l 埘
$ \ ޘ @ P ٘ W
< 咘 8 0 X0pgXp(Ko͘ (K [ ^ 4
-LDMplK W *P `p V @@ U @# T
! ~ P`Zg p~ V
! x$ @p(K茵[
-L . .M K
.-@N@ L `P@
W
4 Kh
-L,MPP0 00 01 ` 0 N n` 0K PG 0 E 1 @08` Pp5A Z@0 00 <0 0 pgD0 80 S)
0 ! P @0 S
0 0 D0 S
) P
h B' 3z03#! @0 < \}80J:C80 $0 0 (K (^[
- P^L$MP00K U P5 A33` @0p80 V&
80 0 @@ @ 0 ! P X
& 0t0
0U 3jF03 @0
}z 0 局 00 0(K4^[
-P `.<0@N@ L 0 噀 KhU꼼[
0-D@L P
;W P 7W
@ T # 30輼
- pL `> V/ @ 0 S P
ȗ P 0 P U P# 0B Q3 0 S
3 B0#33 S Q 0 S ,# U
Q `F KhK E^
- `p PL U A 3 S
9 @ 3 S i~3 03" P * P @ # T
0 0 p Ֆ
0- PPL
D@000 0 R000
0 04
0-L 0 @
P4 寖 0 S
s" " 0
R0-L @P
ۖ U
ז T
K0h 0
-@LlMP`0 H0K0l \ x0 Tm
l0@@ 0@ H0 \0D0 l0<0 < x D< P < @N D04pd0 d 00b0 S00 500
$`< <` <0080 00p0 D0t0 $0h0 H0 S
L 0X0 X0d 6p RH0
SR
40t
a1 `PK
0
P
3
Q 3 S40$ " }000` 40 HH K P
y%
# Y 4 0/ k ` 3 S
J 40HH K` 3 S v}3 03! 47 ` 0 S
1 h0 S40}
$`H 0 Q
@40P L "
`LK PK 0 1/U PK H K!40 L
b" LKPK
0 1/ P
# P 2 0/ A H K X Y
嗕 P0 ` 哕 P03 Y
4 D 0D c} P
H Kq Zo
Zl
0 Z P Kn P
k 展 P00C 0 =
H` 2 d 1 X& 0 0 0c P 1 啕 H K$ H Kw PT
V
D 3dC003= ! H| 0 44 3(03r 1 o h H"X00 S
c < P ) @`0c0 S 0 A` (KP 3
P0| 3
P ! ` B P H < P 303 6 X0 Sn
X0\ 6@c0\0 gꜽ9^ ^%C^
- `L4M#K0 Vy Q0,@K 0f S00$ϔ p&0 K p 0
00 n $KdhOy^ȼp4OU^
-@ LMpKP` `
K\ 0p 0 ` 0
) 0@?o2 P0 S 0 S
0 00 0 R
0 0 $U P
(Kȼ
-L @PB p
0 R 0 R
Q0 b
R c0 R R
0B
Q pb 0P * U S 3 # 4
-L > P 0T0 &
-L P p` @T
0H @0 P
0 D c"&0m$ P
00 S
3/0 00D00D @0@
- @ppL` d 0 S
! S
P Ḿ 0 S
bW @ 000
0-PL @ P
0 S
0 0000 Ⓘ
0- P @L ؑ 0 0W K0h ! ~ 010 /
-L5 岑
0- @tPt0 ML 0 0@@@ @@ @X;<<0@@0@ @@ @0
.<K0 &f^n^-00 S0 ^* S
Q 05 : ^! 0 S
Q* Q : 0 00 0 0 Q : Q:0 S 00 0 0
-L M@P ` R8 @` 8 8L0 S :X0 0 R 00 S
0 V00 1
0 K P
U V00000 # U00
08 0@ S0# 03 R 0# S 0 `
0 8 K p
P
V 000 0 S00 00 0, K 0 00 ` 0
0h p
P
P U
0 T80 p V
Q * W
\ T S W
Q
* T Q
Tp p P S : T
V
Q
TP S W { S* V
d S S *8 P `
0 8 K
pf
P>
0 T8 V0 0 00d80
08 K pR
P0p J
0 T$ V PP V0 0 S
T P 0 T V 00 V0 0 00d80 P `
08 K p)
P
0P
0P P
V00
S
000 0 V0 08 K 0 `0d80
0 p 0 S00 0 80 0 000 00d((K
- @PL T
H P
0 D b 00"&p00
$ 00 S
3/` @
- @PLM4P0L S@! RP1 U@1( Kd P (00(0 ( Q *00
H0$ ?o P2 0 S
b Q 0 d 0 a` p \ *l `V p`n) ₼ K
-P @L M` UHP0` U
@0 S
P 0 0 0d 00 0P v
HP 00p S
4 R
@ R ` 0!0D !6 S C P` V
0<4 V *40 S P U @0 S 00
80 $0 S 0 0 0 @00@00 10 H` V,
@0 S
` 080 PP
4 l04 R@ B@ 0 WHp V
40 S
@00C S@0
!p N P K4
- P@LDMD0 NP0L0 K S!1 Z! Z
p1p! | P 0@D 0 Z 0
ⲻ Q
@ R
⩻ Z 0 R
D0
00CX0
W{ *H`$0 V@0 T
D0 Q
0 0cT0 0 Z
0g0gL0 ӎ L0<0 0H0 L T00< 0b RP0 8
D0P \0 PP-
0 S*
# ' X R# EOEO|EO|EOEOEO R P0 媎 P0# R # R i 3 S PD 00SH00HP 0<0:C<0 H P@0 Z
P1 S
"#K@0 ` @0 X
#Kf Dg 0 @ 8/ @p (K
-LM` K P@p P 0P
T
* R
0 T :400 @
K
0- @ P L? 000K0h{
0- @PLD D0D00
-LMHP ` U@4 T 0 0P i0 4 $p0 U8 Pa S XH
R
0 S R00 ZT00# $0 W4 40 R8 80 R< <0 RL L0 R@ @0 R W
00 " Q Px X
0 P Wp 0 00 U000 U0000C00 0 \ X
D0D0H0H000000 LP00 SF
\B 40 %
H R;
R X6 H R3 0 Z0 TT " + $ W( 44 Q$ 88 Q << Q LL Q @@ Q W
P 0 S R ? X
0 a P
8 X00 S
3/ W
R
2/ R Y B X
D D H H 0 0 X
(K
- @L pp P`>00DH0 PPPLp `PPZ hR $Kk (]u^
-p P`@L p0 SA00 T
w :v @0 @0
-LM P`p $ -9 @ p0 K@(
- @L 0Q ` D` ou Kh8
- `LM LP "# p 0 y0H@00 Ts
<0 Sm pMOMOTMONOtNO 00 0b0a 00
0 % >S 900 P 000H0 S
0 @0 S
0 @0 SH0
S6
,2 S0
00 - 80
40 0 's00000 00 P 000H P
0 D b"& 0DH00
$ 00 S
3/00$000@@ du ߸ ,00 S
R
3/ $Kȼ
0- @ P L 000K0hS
- ` H0L @ SP`f
DD ;00
$ Kh
" 0"$ 0 S
0 S
Kh/
- `L Pp @T 00000 @0@ KhG
- `L Pph @T 000P00@0@ Kh)
-L,MP0%$ S @8 `
y P r y
0 K8 P
08 0 S000
* 0 R * 000 0P 08 80K 0 00 S 0 p< 0圠 c 5
Z
S ᛋ 4 <0 0 P <0 Ꮛ 0 T@ p8 4 P u X8
0 Q P 0 P0 0c 0 00P ! # (K蜽 &
-LM`( K @pP| P P ( 0 S 0 V :( 0 W 0 V$0 SH0 S U
0 QP0 0(0 I00P000 U X ZP0 Q00 Q0000C00 0 h 0 f 0( $K
- SL M `P@p2 07 .
P0L( K SP! X! XP1
(@ P@
0 S * 0 S 0P T
0 S * 0 S 0 U 0 R@% @08 P00 P _ T
E Z
A0 P&
p# T
@08 $ 00 0%K"H000T00T0D0H0 T
@08 00 0%K"H0$00 (K
-L?L00 L 0@ 000L0 0L0 000 0Fnp00 `q ⥱ 0 s 0 s:
P P 0 ' Z- `0 S1! p 00 W #2 Y
0d R
0 ! P 0p P0 Y
S P 00 S
PF P (Kh 0] ď]]
- @pP`LM 0K p D P
] K
-0pD@L P ` R ! S 00 S
R
3/ 0 0 0n 0L P P`Lp | `c m D`m $Kk?ȼ
-LTMP 000 0X0 0 PD 80 P0, K 0"$6 0 )6 D P80 0y
8@4 K P
4 p pg 0 Y 0 Y * 240 p00 p> 40040 D00@0 D00\0 40T0 0`0 00h0 0P0 L0 H0 00d0 4@ 0 R d0 Q
`0 S 0@ R * #400
@0
0 0{400 W p pg40 0l0 ~ @P
H084 0l0 0i 0 c0\ \ R # 3 \ R0 0$ P$ 0
00 S
3/40" 0"40 0 0 8 4 4 8 4 8 8 < < @ H PH D
D 0'D b"&h04 L0L0`0 ST00T0L00L0 00aP0P0 H0 S@ 0
@ Q d Q
R 40 pH@ f ZH00 X 00K0P08D 0L0 0
06 P@ U P Xy
v 0@pD
@0
T 0 R
YT pT 04 4 @ Q# P!
S 4
T0 54 g4 @4 H 4 A H T0pp 9l X 00 S
⯯ ⭯ W 00 S
T
0 P7
4 00K0P08D 0L0 0
0 @ ⌯ T@ @ @ @ @ ~ Z
0 P
^X0 S 8D (K4
-L M P@`080 P0L S@! R`1 V@10 K0 P000
0 T 0 T * 0@00
S
V 0 \ 8 [
$ \ P
` ( O 0 p
TE
0 VB 0 V * 804 S 0404408 Y
j0 40 0 0 i o00
$ 0 S 40
0
0@0 00 Y 0 S
0 0 0 P p@ Zk p
p Ѯ (K0]
-LM 0 D ^ K
0-L8M,000 $0 0 @P `!3 0x3 000`(P @ @ p 0$0H3 0 0!83 0 00`,P(P@ @ o 0,0N?$02 0 0!2 02 000`(P @ Y 0!2 02 000`,(P$@ @ @ F 0,0p2 0 0!`2 000`(P$@@ @P 1
0*,0 0
!2 000`(P$@ @@ @P 0,01 0 0!1'.00 0`0 (P$@@ @ 0*,0 0!x1 000`(P$@ @@ @P 0,0 04!!,1 00`0(P$@ @@ @P 0,00 0 0!0 00 00`0(P$@@ @P 0,00 0 0!00`(P00$@@ 0 @P0 $Kk O^*^4 O^{O^Լ^^༁^ ^ )^x;^ |4^p
-_LM⥏K K K@ o$ K4 ``A```` `a`abbbb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i`j`kokmlnlmmnmlnx`c?Kn```_?K`C```[?K`C```W?K`C```S?K`C```O?K`C```>`C```>`C```=`C```>`C```>`C```>`C```=`C``` >`C`` a >`Ca >`C a`a<`Ca`a!>`C a` a">`C$a `(a#>`C p0`` p4` =`C p8``%> C oK ?#K` TĂ R
0 S0!2 0` 0 0
00 00 00c (K4
-LxM@|0K P` p` T 0
< Q< < 00 0 000 00 00< K
-LM⬁ @P`` K0 0 K\ . ̀ p\1+[[ P1 ;[ P
0` ( \ ̠
$ A
\ 2(1p3B(1 08C8$ YK W+K ^;K0 K U 0T 0a0 00 0 0 0 0K00 0 0 00 00 00 (K/ /Լ4
0- @ Ld 0 /0 S
/ /
-LM p`K` 0P 0@0 0K\0 0` @ 0 0 000
0 ?o2 P0 S d Q
@P d (K
0- @ L d 0
00-L8M 000( ,0 0 @ P'. , $0A 0 r K0̂O
-L M@00 `40 00 Pp 0 >0 0>0 0 :
"F<
S 3
S:L Sr * Q
00C 0 P
0D @
Y XY
Q '( Q' 0 0! 40 P
40 S8
2/3 T3
/
R 0D '6 S 0 S
0 <46 R * y00 0 00 0 0 0 @P
00 0
(K [4 N /N /
-L$M @: 0>0>0 T< *0!P#6DpH0 D 0H 0P@0 | B0 K z P+ 0@0 g < Pc < P% <$` Q 1L 0 $ H0 S80
} V
} L0 T$ : V
,~ 80 S
'~ 00000 000 Q9 Q
R* QL0 T* IJP80 S 0 D a P
0! V 00 S
0 00c 0 g HJP D0H D g @ (Kď]
-LLMP 0@ T0Q`H0 @
N(@@N P@ \K
0h*H0 DP S :L Q 3 : ST S
D! 0Pp@0 7/H0 S
D @ PH %H0 5 PH H0 0<0 @0
J pP X
0$0 SR
D0K 080K0<0K0@0K 0
04K$J0Pd@01N@Dp0 U L Q0!03P U03 S T ( K P(0 P @@e X 00 0 p K
-LM ` :.#: . R `c01@ VDp 00LP U03PP VP!P3 U Y 0K P P
7 K@- 0*>"*0b .01 QD 00L@P T03 Q03 S @00* - 0*>"*0b .01 QD 00L ^03P Q03 S 0k - 0*>"*0b .01 QD 00L ^03P Q03 S 0 S ȏOȏOȏOЏO؏OOO0 0
-LM0 00ʠ>0,ʠl Q 00D L@ T03P@ Q03 S
XP@DP,F T @ P"*0b .01 QD 00L \03P Q03 S
00] P K Q
0 01@ D ` /
-01LD S,0,0 $0. 0a b /8x
-L M` 0 P S@ D 0P@09/ @` P
T
0T 0 0 @0 `00000 a 0D ^ $K
-L M 0 P S`@x0 D 0Pp@07/X0 T
@ ` 0 0 0 D 2 K
-L4Mp8 P 0@ `0:
0: 0 Q@0 *
0 P *0G|<0
W 0w
W :80L0 W * X
0pG 0 <0 S P Xp ,0K # 0( 0
f 8 Pp5 X
X p
pD! 0P @0
Pd ` \0 R T 00C0 0 R0 00 303 0 00]l h ]d
-`L 0 S: 0 0B00
4 ) 0 R0 \ 4 Q^
- ` @pL
P P
0 S
x u)
P
P P
+ P @ T
l ^
-L Ma @ 0Q S b0>0>00 0>0 00 0N@NH V@
0f T
ꠀp 0 W a W | %)0@@N@N@ T *( K PH
0 (\J(0 ` Kؼ*^*ܸ^ ^[
-D2D"DRLM0 04 8
Ew Aw 2
p (2
` @ [ P
~ ` ` h @1 p R @ D 넠
n h200 B a < 00 p 1 W aP0 00 y 00
P
E 0
5 000`
00
00
C$ x 40>0>0 0 08 >0 00D (00 , (K*l +^4 P *ؼ
-LMK
p
, K 8 /
-L,MB P 0 S 0 S
b pdv 0 U80 Lv 0 P@0 0E 0 20D0 2<0 1 PL0 0< 4 K1000 4 0 K 1H0 80 \R 1P0 ! 0P00 SC
Q Q 8 4*
Q
8*08 4*
0
Q
8*0 8)0 P4 \0H 00D 1L0P U<@0 P`Mv U
@ M (K4 l *0 N 0 : ϛ l
-L M `8 <0 @ pu x2xP8 00"600 u 1 S
$t l ? R Qp R _ R@ , R r
( R ! Sk @ T W
W 00K 0 0 P WU 0pK p 0 P p 0 PD
07'0 ! T p
p p Q ҵ ŵI 80 `#(0<0,00 S 0
#
V
#D u T
# W #
8 T u
(K 4 l W^ؼd
-` @ PL Pp"" J Kh
- `L @ VP
1 U
P $Kk
-LM 3P0 S
2 Q 00 u P
080 00 040 p 00a P 2 0<0 @ T
40 S P Q Q AA u 8 ^ P' 0 t 0#! P @! R @ `` J @ $u P $4 t 4<0 <0 P @ Q @ $$y Xpn Q D 00 p000 0 80 S\ 00 (Kot (K4 l
-LM K ab K 3 S /
3 -0C8L#8 S3 00C0 4
0- @Ll K0h
30- SL @ 00030304 3 S /Q 3038 LS3038 8sU
- L
-8 L
K hg
-#L @ R/
P U
303 0 S
3 B#
03 0 0 03
ᒶ 3:#033 S
0 Sc $Kk P U
t 0 S
PD P
v3$q尃 S 030 0C0P P 0 `8 s 030! 1 0 S1 A 0 X00$00$00 1 0 PA0004 000 Q(00ӵ0µ$Kks d 4 l ؼ
- p` PL U A0D s
3
3 03
03 GP
- 0L S 0 S
s
-LM@P 0 S
0 R dp0& 0K # ` ӵ Q
&0( KX+4
0-LM @0 @@ @ 0 K K @ \P r @@ @P0@ 01 0 S
3/@ TK0企X+l l]
-L+ù^˹^ӹ^۹^^^^
0- @LP< y 3 R#40 R h A $A$( 1 B 03 03 0 0 0 00 0 @ @ @04
-pL M `k \1` @ TG
0 R00 0 3<00 03P P p ) 0 0"0!1 ^ PP@ QA 0 0 R$ $ 0 R 0 0ӵ0Ƶ(Kok 4 l ༁
-L,M
S@!0J3 00p R #2 \ Q D`A` ^P %V` R :
T0 S
rk %(0, 0 R P '6$F80 0D40 0&f#6 0c<0 000 00L0 H ps P}
00 Pu 80 S 0l V* @ P @!@140@D @ 80@ S1 0 !@0 RD @ P X V !40@@ @| 0 P@ 1@0
R
< B$
40@ @D@@ 0 P0 E `
0H0 CP00 X P0 m
HP0H0
S
a L A D0` k 0PU
}000 S00 f
vhtk '680 0\&f40 Lj , (00 Rq 000 00D0 @ P`
4 00 PX
p 2 P p! p1 ` 80 S 0= V*808@ 00= 0"" ,0C# K0l +#^2^
-,PLM 0d@(0 `@( 0p S 4@ 0 0,0F$(0K0@0P 0 0 _ ( K+
p-L M`0 0P S@|| x0 0 Sp
T ` r \X % * Klh P @ h, 402"P`$@Kpl |]?^4 u^k^^^+
- LM`,K! @ PP e p P *yZ 1 80 R 00 S
( , PX100 0 ! : P
C Z $1 p W pG p,0 `&& T,`3 XF,F @ Z 80 R 00f 0,0 R$ ppP0 P& ` ,0P $$X 0`f ` < P P (K莐]һ^^l +PT^ ^4 e^
-L(M P` pcK p `p(K`#K V0 H$H H@f$F(@ g 0 0 00 1/0 F` p $K
0 -8 ML 000 00 0 } K 艼^4
-L 2 P 0 0 4 Z4
Q P-LMP @`pa
Q 0! V0 0!ı70 8` pa`0 @ V P S R/ ! R0 0!ı! R bZ : #Kf #K V 0 I 0 #Kpf #K!0 ` pZ#`(K
-g pLM@ V@ @+ K|0 R
0 S
4 \ Q
8 < P<< 8 0H BH 80 / / 74 \0 R
0 S
( Q , P 80 / / 7
0-` @ L P U
R 0 P ` S
R 0 0 S 0 3 0 `800$ <00 @8@@H00H0 74
0-H0L P
0 @ S T000 0 7
-@0Q p00P0L 0ghP0e ( ,] P ( , P $0 R ` `e 000P0pPpe 40t0 S
0 ``F V ` &`4 G04 0 P
"2 {e L0pgLpT0$ 0bT04 P XX 8 e , ( #0 H P 4 7T :]^ 0 & 7
-L (0M 0 0 f K $QtO
-00ML06 0 0 f K $QtO
-LM600 p1! Pa4 P 80 崣 @P
0 V ? 6%:V T[4<0 6
S 7(!<0 !<06
!$0 000H S0 | 8P 0 d 0T T "e X
0 040!800 R0 0 0 y XdP * ` u00 S 0 d 0 d s (Kl : !CeO
- @LL D0 R H `P 000L00L00P d T0 0T0d 6\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
- `@L $0 b0 0b0 00C 00 S0
0 S
R0 0 S 0 <
L00CL00 00 n $Kk7 8
-LK" w Pt0 S
! 0 S 0 !B" P
1 x(0,P a 0d00041L L P P6a P8 P P0 P
1 0 W
" U'
` a H 3 P ` u P a P 0 l a P
P P P e (K4 8@'0N :˽^\^ ^z^^^Խ^^ 7 ^TxO^]#^
-L rߌ ` P U)
@ T$
0
4` d P#
p
` U8 <0 R0<0<08 H00CH0 V
18@ PT =< ` 0 ,Ko p M` W
?^8 7R^4 ^
-L ML pH0P S K 0 S Q E
0 0.` ` V2
@ T-
0 (
0 0 S" 0 [ p
8<00 Q<00<08 0800<00 @800 00 0T0 0T0A` ( 0
8@ ` 0 S 00 S 0` (K4 7
-p`ppL _ X@_ 0 0 80 0P@ T @@ ` 4 T
- `@@PL _ ( X00eX0$0$ Kh_ 4
p-L `P
P _ p @( a0 0$ 0e 0 0TeT Kh_ 4 0 0 [
0-LM`P q \0 0\0
@0 6 KI @P ( q_ X0 0CX0_ K04
-LM@0q` DP\_ @N@N@ T(
@0 lЂ Q Pp p \ p#p2 W
_ + Ό&. T(
0 0p0 b(K pP
l_ (0@c0$F d / (0@d0$FC @Z_ $K 0@-D0 S d0&0b Q *10a#Ơ@0 P 08 @ &!6* U \ 0 0 / R />0 . 0 @0 -0 >
-L M#Kt0` @ SP
@ 060p #K #K p` P(Koz
- `pLMP 0 g @P 0
= # 00 0 0 @P/ Y ^ Z3
Y03 0 0 0 ^
303 F P0#10#0 S# 0 @(K|^^
-LM#K( @ p` (
@`pGQ W, 0 PE R
Z
$ #K P
@#K*R 0`pG#K0 P R
Z #K* 0#K` V #K m P
@ 0 `(K
-LM 0 @ p ` 0`p ^ $ V W
0 0 0 0 ] Kk0^
- @L `p] d Kh!^ H /H /H @o /
0- P,0L @ T
6 P @ 0\0 /\
-L 0 8\
-L M ` Pp 0 P @00 pP0
PP 0|P R @@ 0% K P000 P8 / U 4 P @ @ K8\^`
0-LM PP $
崉 P
0x S K⯱ P
P 0 S0C0 @ @( T $ E K08^\`- /
- @Ld ` pPဉ \ P@
@ T@
U@
4/ @` ̉ 8@0 S`00 /0 P Q / Q /0 P
P P / /
0- @L 1 ,0 0$0 0 00 0 0 0 00 P P P` P ?o Q P0@-2
R 0 R
0 0 D$ T00 0 0
-`L @P T` @000 P#
p W#
P
P 0@ S
p@ P P @ p W 0 S 0PP P@ P
P + /ᠽ 0 /0 P Q / Q /0 P
P P / /
D00-0<0 @ 040L0(0 0 ~ 0 0 00P PdP P s P
P /ᴽ
- `@ pL 0 ^c P UP!0 T 0@
K 0 00@e p c 00 0
-ML M P `0 S A
0C0 0pBK04 @j I T
T1#ph0 P+ 000C S : 0C R
X@` 0 @0$ j* @ (K
-LM @ p`_P 0 0K ,P ( p0 l h K
0-LjM @L1 P 0@0K)
K & P D0.K 0!>K F? K 1"K K& @P 1.K% 0 K?K K0¾^^
-LAM P
00a `! d! !1 1 0 04q8<@ T
ġ
ȡ
p̡
С
ᬡ
ᰡ
ᴡ
ḡ4A
00 0K c 0 p 弐 0Kg @ tx0 |0 [ 0 x0x0 1 t 0$0p0 F[ l h d ` \ X 0k T0 0K| 0\# 00KGK1@K< KK0n @P 0$# 0GK0/ G K F @P Z p W
U 4qG K 8 P
@ Z 1 T 0q90K` %l2 0 0;K40
KT:K( V0 \0 0 0
KKK K)KjKѾIKѼIKѬ@ K K K@K@K @ @ 9K#40 K ! @Pe 1 V 1bv0c 1 尐 0 ! p0 0A K C/Kh { @PC ( K(0 K ` d! @P; 0 S @1 1 1@ @@ 0L! @P Q U
0 S10 ?! P P
U 0 S P .! P
@ W
a P 0 1 (K/^ELF P 0 000 /8 0 00 /@-M
0
R
' R@
0C8#8 S @ R,
R 0 Q8!#8$ S ܍8 0@-'@`pPİ+
++' R
R
R
S : Q@0` S* Q@0p S* Q 0 S*0 \ S* 8
-L M` 0 s0 0 p Q
0A a 0 c \:#:[ 0 c ^ P P@P@ @c0 040 0
S :0 N@N@ T
T
00 pP0 0 p R 0 0 pP 0 d 40. 0. >00>0 R
@p c pP@ @$ 40 0 (K/P1P8-P
-LM P`4 P o pKx yd@ TG
00 0$0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0 0`0 ` 1\0 1X T0 0 0P0 P 0L0 ~
0D0 01x@H 1 T @0 0`@hP<0 `Pk8 P 0P00 TPg
0x00 k @ P
@@ P@ P@ @$K P
Q o5 (5 /Ƚ
0-PL @ P
0 S
1( S 3 S P 0 0Ⱦ^
-LIM0 P3 S( p P* 1 S
S ` `2 S
P 22 1 1 0 0 @P 0 ,0(040002 P" "瀂 R 0'0C S@ 7 w0 0 0 @P F00C P 01 h0 @ T
,0K # 0 14/ @P0 1
! V
0@ H 0
`0 ( - Q T@10 S
T !
3L0 P * C Z @D @0 " 0 T @ 0 1 00 0 S
S0(1 2 Y$ 000K 0 0 0`. 0. D
0
(0101D0 >0#60KШ
- `L @ V 0 0
X0 0 0 P V p
$ p
-0b` pb 0L @ RP : 00 0 U@ P
00 0000
-xL @$ 0$ 0 S P `
0 U *05# P
P 0 S 0 00
-LM0@ S 6
* 0: `0
+ ( P0q" P L0 x L0 0L0O 00 0 hqn ` 0 D U @P
0 03/ K
p-L$M 00Q 2 @00 0 0 0 * P `0
#< V
0 0D . . 0 Kp
0-LM P @ P
00*"*0b00 0b0P0 0 0 0. D P K0hK0
-L(M 0K02 000 0 0 P P K
-LMT0 p $#00<0<001@0C U T@@@01< @<`@p0bPg 80`g` R
0b 0Es
0 0 0 00 0P0e 0 P 00 0P P0 K 8-P
-LM0`@0 0Ѐ @P!
P0o/K PV p W PT0$ K 0 02A 0@ P 0 $K8NLN@NedAHN
-LM0a0C k $ Ⰰ R S 0 S R 2 K - P b Q |2,K @0!2 P 0 0@0*D P
- PD0 x 0 7
haA T
T[PY K7
P ` 4 K P P K P F P ڰ0[/ S ,0K` 0p0F@K 0 0 T 00 Sp .,Ap TT!0P0
-0`0K`
s00K 0d K0K P< HaP @Q 04 T0
Pb P$ 0 0C /P 0 0 ( P0 d P KP ` P KK 4 00
t Pph (K/^9:ȟ]^^(^ P^]w^^^^^^^ Ŀ^Ͽ^^^ -X` P𝤀 0 !`!800 , , !hsss 0!< 0`4 0 , ! /hsss
0-,0L @ R
0 K0hR LNHN
-L`0` P , 0 d U F
?,d 0{ T @! T+
-LdM00@
0 Q00h K 00 hK -h K @` T ڴ 7@D !@Q h K 4/0 & :h K" hKt 4/p0h K0 &#: hKL 4/K9XCT]o^]]YL^^a\^NT]A]]T+]4 ]
0-LTM,0? @0?` P0'> 00P(`$@ @@ @ @ pᑟ 0,0h? 0\?0'>0P 0(`0$@ @@ @ @ | 0,0 ? 0?0'>0P 0(`0$@@ @@ @ g 0',0 0!> 0
< 00P0(`$@ @@ @ R 0,0> 0t>0l>0P(` 0$@0 @@ @ @ =
0,08>,00>000P (`0 $@ @@ @ @ ( 0,0= 0=0<0P 0(`0$@ @@ @ @` 0,0 0x.!= 0
<0P 0(`0$@ @@ @ 0 ,0 0!D= 0
< 00P0(`$@ @@ @ 0,0 = 0
< 00P0(`$@ @` @@ @ ՞ 0,0< 0
< 00P0(`$@ @@ @@ @ 0,00$0`< 0T<0<0P 0(`0@ @@ @ S0,00$0< 0< 000P
(`0@ @@ @ ᕞ 0 ,0 0!; 0
< 00P0(`$@ @@ @ သ 0,0L; 0l; 00 0P0(`$@ @@ @ @ k 0,0(; 0 ;0;0P(`0'>$@ 0@0 @ @ U 0,0:0: 0<0P0(`$@ @@ @ @ @ 0,0: 0
< 00P0(`$@ @` @@ @ , R0,0D: 0< 00P0(`$@ @@ @@ @` R0,00$0:0 09 0< 04P0(`@ @@ @ 000R0,00$0X: 0 0|90<4P 0(`0@ @@ @ 000R0,00$09 0 0 90<4P 0(`0@ @@ @ ϝ %0,08 0
< 00P0(`$@ @` @@ @ ờ &0+,0 0!8 0
< 00P0(`$@ @@ @ ᦝ (0,0D8 0
< 00P0(`$@ @` @@ @ ᒝ )0,07 0
< 00P0(`$@ @` @@ @ ~ *0,07 0
< 00P0(`$@ @` @@ @ j +0,0`7 0
< 00P0(`$@ @` @@ @ V ,0 ,0 0!7 0
< 00P0(`$@ @@ @ A -0,0;$06 06 060'>0P@(`0@ @ @ * .0,0t6 0h60'>0P 0(`0$@@ @@ @ 10+,0 0! 6 0
< 00P0(`$@ @@ @ 20,05 050<0P 0(`0$@@ @@ @ 30,05,05000P (`0 $@ @@ @ @ ֜ 60,00$085 005 000P
(`0 @@ @ @ 70,04 040<0P 0(`0$@ @@ @ @ 90(,0 0!4 0
< 00P0(`$@ @@ @ ᖜ <0,0 0$!@4 0
<0P 0(`0$@ @@ @ 8 倜 >0,0 4 0800
<0P 0(`0$@ @` @@ @ k ?0,03 0800
<0P 0(`0$@ @@ @@ @ <@ @@ T `3080 0
< 00P0,(`$@ @` @@ @ ? @0,03 0 30<0P 0(`0$@ @@ @ @` * A0,02 020800P(`0'>$@ 0 @0@ @ @ B0,0 0|"!\2 0800P(`0
<$@ 0 @0@ @ C0,0 0$"!2 0800P(`0
<$@ 0 @0@ @ D0,0 0!!1 0800P(`0
<$@ 0 @0@ @ қ E0,0 0t!!`1 0800P(`0
<$@ 0 @0@ @ Ἓ F0,0 0 !!a HcP^dVP^^^UP^p W^,R^^^^^9^: ^^"^aP(^eP^9_3^7^?^G^O^_^g^t^|^^^ZP^^^]^]P^XP_8aP>^^^^^^,gPB^X^P^ ^,^=^L^Y^
j^^UP^eP^[P^^^ :^YP|^^^XPS^^]^]^SP^0 0800P(`0
<$@ 0 @0@ @ C G0,0 0 !0 0800P(`0
<$@ 0 @0@ @ - H0,01 0 1 0800P(`0'>$@ 0@0 @@ @ J0,0d1 0l1 0800P(`0<$@ 0 @0@ @ @ K0,01 01 00 0P0(`$@ @@ @ @ O0,0 2 02 0<0P0(`$@ @@ @ @ ך <0 0@0 0\2 0P,0<(` 0$@00K @@ @` <00@0,P( 02 $@ @0< 000K @ @` ᮚ 0$02 0 K 0<0,P(0@0 @ 02 0 3 0800'> 00ᔚ ;$0 0 0<00 K0@0,P( 0l3 @ 0x3 A0'>0} 3 0 K 0<0,P(0@0$@ @ 03 03 0800'> 00f <00 K0@0,P( 0 4 $@ 04 @ 0800'> 00P 0 0<00 K0@0,P( 0`4 $@ @0l4 0800'> 009 4 0800>0P 0,0(`$@ @` @@ @ % 4 0<00@00P, 04 (`$@0<@ 0 @0 (5 0<00@00P, 0L5 (`$@0<@ 0 @0 <00P,0@0(`$@ 05 @ @05 0800'> 00 (K
0-L8M!1 @P `000 00`,P(P$@ @ @ pÙ 0,00 $0 0!0 000`(P00 @ @0 ᬙ 0 ,0 0!T00`(P00$@0 @ @ 0 ᗙ $K^$WPXdPp ^^
-LM$Q (R `p@0
R0
R 0
R0
00 0K` 0 KT 0 0 @00 0 0 A ?o2 P0 S R 08 R TPTPTPTPTP7 8 8 7 0$K9
-LMp0P `!** @"&9 !|0K ` d0 KL 0 0 0000 00 KP'
-LM pP`K 0` @0 @0K\0 0 0 0` @000
0ה ?o2 P0 S (K`N
-LM pP`K` 0 @0 0K\0 0` @ 0 0 000
0ᬔ ?o2 P0 S R (K茽/u
-LM@K P`p ` 0 S
S$ 0 00 c":0 &$0Kh # l0l 0 0bS 0#610 0KT0 0@ 0 000 00 00e $KT+4
-LM@0p 0 P S` 0"(K|0K` 0 R
RK
Kl !00L < 0 0 0000 000 KW
-@ LMPpK` `v K\ 0 0 0p 0 `
0?o2 P0 S
0 0 P 00 (K
-LMA 0 ` PpK` <+0 \P 70 p 0 0 0
0 ϓ 0 p?o2 P0 S 0 0 pPp 0 Sp
+\0 (Kx
-LM@ 0 ` PpK` +0 \P 0p 0 0
ᆓ 0 ?o2 Ppp W 0 S
+\0 (Kx
-LxMPK @`` p0 X 0
X
. 1D0 S 00Ө? $ 0@D0 D D T H Xh0ը 0 0 0 0 00 00P 00/ @DT $K-
-LxM`K @P` pq1 X 0
X
; U( R( D D0 S 00ө? + (0@D0 D D T Y ʀ H 0 \ 0 0 0 00 00` 00ڒ @DT $K-
-LM_@ ` 0 pK ` K\ 0p 0 0
᪒ 0?o2 Ppp W P0 X
?o X2 0 S0 0(K N
0- PL@ H 0 T
MH 0
-@ PL0a x 0! 0 D!(0:0L1 00$0Dٙ $0 $ $ә $0 $ P0(00,0(0 S 0 04000$ t0 l ? S Rp 0 S080t0900 S
@ u 0 l$ 0 0%< !0 \0X 0`00d0x0h0P Q l l Kh
z]]@B
-p LM ` @CPK ` _0KT0 0P @ 0 0 000 0 ?o2 P0 S C0 P $K
-LM@ apK ` P0 K\ 0p 0 P0
Ǒ 0@?o2 P0 S& 0 0 0 P 0 R
K➛ <0 T a)K ?)K Q 0)K$000 K0b (K落ɚ; 6e
-LM pP`K` 0 @0 ܾ0K\0 0` @ 0 0 000
0s ?o2 P0 S 0 S \0 K _0 ` P 0 0r @P0 ` ĕ뿎 (K舽ļ
-LM R `p@PK
A?K` ᖾ0 @ 0 0 000 0P . ?o2 P0 S $K
-LxMP@K `p` p T a0 D 0 0@ 0000 0 0 $Ks
p-L MP`k
00 @ 0 S
0 Kp$N
-L,M pR` 0 2 0;
@ P aF L0K0P0 0 U& 0 0T0 Z
X L KƽT0
0P H L0 xd F L K H :F Z H @P rF Ȓ
@g @(Ks
-LM Q `0 @ P u R
0 \ T@ @ p0좟P0 塒 w
pE 2 Xb
`0 Sc E O P ,F O 0 0 r p #F WE
E U010#pᔠ0 Z'
0 Y S
K
F
F K9 P
qr $ E Rf
Z4!0p e0C0 @4 E [r V
0`f V ` # *9 U 0
M @ / J ,1 E 0 0 r P
1 E E U010#0 Z"
0 Y S
^K
i E E K P fE R
Z4!0p e0C0 @4 E <0 SE r ] E q # R< (K/@0
-2 00`0(P @ b 0,0<$00 0 0!0 0'> 00`0(P @ K 0 ,0 0!|00`(P0
<$@ 0 @@ @0 6 (K ဌ/ ]^]^!^]^lO,^@qPhN5^@^
-L 0,0$@ @a@ @P G 0(00 00,$@ @a@ @P 6
0(0l0,$@0 @a@ @P 0 % $K^G^^ _p^^^/_^y^^^^0
\0- CL 0@ P 0 R
P 0 0 =
-(L a 0 @` 冩 PP0
a W V `3 p3 : `Vp0P S
S& 0 0 1#d 0? W V 0t0 d0 0 1#d 0, W V 0,0 b $:^^
0-T@L P
t0 S
d 0 0 P
0 000$:
- L Dn `pP@ U
0t0 S l x n P0 L 0u 'n Pn 0 ^0:$:^^ 0 0 00 n $:
- 0ML0 0 `p : @Pc P9
B Ks PP3 P00 1P Q 1 j
AK` PP# t0 S
P "Ks PP
)K?
R K ަ"K K| PP
" ' P m Y 0 S
000 0 `P
I@
R
<0P$ 0,0 / @P
9 m $K$:^wP0:
-LMR p0 S @ l K0A寸 m 0 S P da @0 Ё
K @0k l Ko A 0 K 0K _ WA K <0K| K> C%Kԕ <`> C'K R00t'K` Qt R 0='K t t| k(KK K 0 'Kht Q 0=A'K At D1t |0
41 婟 K
( $0 0, ࠟK@0< AKw L z `H @ l0
100 S. 0 #K@ >0 40K 0000 000 0 0 @0l K PP
< v
K@0$ Bm (K$:?B /!^0:
0- P,0L @ T
彶 P@ 0
- PLM p@ ` V
0 00
00 0 0^tF^\^+^u^^^^^ P /L 0 P 0 S 0 P0 R 00
-L P` @l j PP T *k 0 `0 00$ @ 00000Pk <:
0- @PL"
j 0 T 0 0 S0 T0 R 00 $ 00C0j K0h 0<:
-LM \
P
P
e K
-L M0 K 8:
-dpL [ P` @ `@PDPHPLPPPTPXP 0 8:
0-L @o 0P
4P K0ha 08:
0-P @@0L@ @0D0D0H0H0L0L0P0P0T0T0X0X0\\ 0 K0h
0-L P @ 0
0- 0L @ S
P 00
0- @PL = 0 0000 = 0 0 K0hl 0h
- 0ML00 00 A K 8:
-LM0 0 K 8:
-LM0 K 8:
- pPML `I 01 0@@0 @0D0D0H0H0L0L0P0P0T0T0 0` `0!0 pP I K
-LM0 K 8:
-LM0 K 8:
-LM0 $ K 8:
- 0ML00 00 $ K 8:
- 0ML 00 $ K 8:
0 -LM00 0 $ K 8: 10 0 0 / 8 0 7 /
-LM \@ 0 4 ( - P
t P K8:
0- @L < 0000d:
0-404@LQ0 U00
|< 0P00d: 00C S0 /0< d:
-L< d:0 /p:
-LM0p 0 `0 0 P 0@K 0 |0 0 0 R ` 0KT0 0@ 0 000 00 00ᧆ K蘽p:
-L C "g `P 0 Z P 0P ?P09 U
9 2 9 / k `P
8 (! ` RP
( P P 9 <2 9 U
P~ V
4"h Q. $0P J/K 01 PPk (` RP(PWP0 U01[0 `P PY
0a 0 0 1 '- CK PP
I 0 (1 (t0 S
P7 K* P0 S P U K⒞ 0 *K`0
0 0 S
0 00 0 00 0 00 K( .0E K$ 00(1 1 0 1 q I K 0 3/ P( (j U P X
41 (Kx/ :ľYL^A]8^K^ ȟ]
-L,M @P!"K 0 pQ 00 0"Kp 0 S `P
0 W0!D0x <k/`0 $ K+^/_=^ /\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
0- @L40040K0h
- `QL40q04040 e8 0 @ T#
^8 0 X
8 0 V ("00 S
8
P
40
P
L n) $A ~8 ,Ko y8 w8 z40040,Ko/ /@
0-<@L 0 8 M J K0h -@-
0- @QL
7 @ 0! 1 !0 N 0 S 0 9 0 Ab C$ P |0 T100a Gs : w 0 10000000-q^x /0 0 S /-
0-LM PQ @
4 ) 40 % 04
S $$ Q0 0 @| UH 00 40
, 00C 0 0 "K0輝PP-
0-PLMp@x7 h1 U
\1 UM T10 0G H1 U=
@1 U
B 0 0 0 0 PP8 1 0 P :P1 P
P* P, ®0 P 0 U* { P
40 00040 000(00,0 00 0L1$0 P UD00 0 P P c7 K0@- c,c@-cc,x
- -LM0 0 . K : /:- / /01( / : :# 0, / Q
-PL@n @@H T
Kh6
0-@L R 5 0w^
-@L/ D
6 011>10 Pa1?1?1` @P
U
0-@PPL 6 @0< 0C@00 S 0 6 K0h6 -@-!2 ! @! $!!! r!E 0! 311 S
- A `L P
0-L T0p@-!2 A! Q!5! r `R "!P "! 001 Q !AA 2 S ^ 0C 01p2 0 Q 0 S Q 0C Q
p
0-@P@ L ᔭ 6 @0 S : T6 pp 00@00 S0D00 @5 001 :6 0-^μ^ . Q-
1 a> Q " R q
0 o` 0
- px0L @ T
`0 S @4Pm 5 0 S * P
P$p0 5 @0
- QLM 0 |E 坃 Q7 0p S00 00 00 ?o 2?) 0H S% 0 0 0H?o R2 0 S 0H?o r2 0 S X d5 @3 _5 3 `00 V
`0 S ` t0 S
0 S x0 R P E5 P P0 @ }5 T@0 0 *b P
2 p5 4P= 0 (5 1@ 0 00 0 0 R| *0 Z0 r
P Uo
X `2$ 0 Rh
0 W 00 R 0 ST
0 0 5 x0x K0 v
K ( 0 4 K | x 0K K K( R p KKt| L xH K < 8 4 5 5 x W01x0# K { 4 Z 000 00g0 X0 0$000Cs 000 ~
@ 4 0 4 Ma Bl` X dP 00 S 0 00 0 4 ( 4 0 S
0) 0 (K\N/@00
-LlM R P 2 @03? 0 U 0 t ]{ @P# 0E`p0 Z4 X2X` U4 L2 P U
`0 S P@ R 00 S 0 y 00 01`h 4 ~4 `Ӏ o t0 S
24 0 0 0 0 @ i4 T0 0 a P
d1 ]4 4p= 0 4 1t@ x0 0|0 x0t 0 R9 *| 0 S| /
p W,
0 0 3 0 0 R
$ Q 84 p ? R h 04 @ @ l K0 崫0 &4 @0 lK z P p0@`@0Cp0 0$0t00t0 @ 4 ,0 3 }` Ty
{(K- .\N/0@0
- @8ML t3 p1papq0l1 `@ 0@@0 @ DQD1 081@@ 0,1@ 0 : 1 @01@@ 00 0 0 0 ,0 0 `pl!P0 000($@ @ @ M0 ,0 0!t00(0h0$@ @0 @ 0 $K- Pμ^t8PD- PDP^P|P^;P,P^
-@4`L] A3 1 R ~3 @A T
@ T
` /3 00 000m3 k3
p- @L$M ` 3 0P PE U0P
Z3 W3 0
(0 S 0#K"K 0 040K QK"K P
0 3/ P0 { KpD-
-L,M1 1 r01] A2 ` V 3 N 00 01 S @
O P
Ǐ 3 0 S
0 03/ 2 01 S
H H
`0
(0 S
@ 2 v 0 2K@ 0 $K#KCK2 @0 0 D0K 2 (K
-0L1 ` 2!1A S 0 S Kh0C0CPQ E U
PP
0-x0L P1 2! Q A T
1 S000
@ T 0 0
0-L @P P
(0 S
00t0 S 0 0
-L` P@ P
(0 S
& 0 0
-LM K K
-L$M @4P
D 1 100 @0p,1 0 Wp!00 @ T010!40 180 1<0 40 02@0 80@ < Y 2H0 p `%
H0 S " 3 p`
40b S 00A R `0 #1
YD0a `1 T@# @3
1 (K脽D-
-L M 04@40 00 1 P1 U2Ӆ 1 D0 0 02 80 02 `b Y p <0 4 K0K = @0 z1 넡 0 U
@ 1 Y> 0 : 0 4D B h ڨ U ڜ1 S
Y 4 4 ! h Ũ<00 800 ! h ศ V ڌ f401001
q@ t1 (K
-@ pP `L &1 00 000d1 40P11@
-x0 p@`!L0Q P
Z
`1 2 ! 001
-5L0M00 0 @P00 R Pa1 r1 0 S 10:(1 <0 . 0 "1 40 280 4 108
1 c 0P
Zs 0 11 R40 0 40
%;0 0 0P P P10n X
<0 0 (KD-^
-4@p1 P1 mL 0 0 U
0 Kh D-
0- `P!L0q b P
R) 0 @P 1 R U
\ P 0
P D0 n 0 0, @ D-
0-@ Lu @ !0 0
0- @L 0 @ K0hd
0- @PL 40 g @ 90 10D-01 240gy gu
-LML2 101482 E 0 @1= 40 / q1 W PńaՇ0P c U ` Pn ⟧ I
G UP ɒ 0â Z?҈1Ճ?Ҍ1 b/c >
! 0 ! ,1 11 P11080 000 U8 80 Z1
` V.
( Q 1 UQ' < / 0 < 0 / U ڌ0 00` 0 02"!!! r!E 031 P4 !/ (KD-
-L M11 B01`000 -g٠ PX P `p U! Z
P
R
00
( \
` `` B U 0
`P^ X
8 ⛦Q 02 0? S ڌ E P
! 㕿 011 Q PoQQ ~ ?1 0a (Ko (KD-
-LP `p@ P"
0 t1 211
t PP R
@ 0 @ 0 @P E
-0LQ0a4@1 S ڽ @V4@ B1 S
PaQ`1 U 0 S
R
R
P
0- QL p @ T @d
T
l` . ~8 P P P. T
<0 d108 P U @ vt/ 2 R ! /0 Q ` /wt@
-L0M PPp`@
0 L K˥4@ d@@p <` K. U =8 P
LKc e@8 P
0 LK5c z. K/
0-L`@ T"+ 04 00( 01, 0 0 Q- / /- / /- /- /- /- /- / D / 0" / / /
0-@PL f@ ?' 00:00
- @p<`L Q
P @ 4
- PH0L p@ U
` Q
P
P@ ` ;
0- P,@L - ( ,0 0P P- 0$;
- @LP T
D0`00pH0 - 0 0P- H]
-D0QL `P@
- @ ? R" 0` `U
-
- @D0LP` i- 0 T00
T0 Kh-
0- @PLP R- 0 0 0- P@ : ( K0hC
-@`L PV@ : Ậ @ ೬ @ T V
@ 叞
P :t $ ( b pP
`` - 0 0 0PpQ- 0 Ǝ 蜽HP
- @PL` , 80p080 080p04 00 @@0@@0@0$ Kh"-
0- @L| , " 0" 0 @ PPP : P 0 I P P 勎 K0h, $;
- RL @P`
H003/H0 0 S0!!#4# 0 11 01 T p
0 T 0 0
, , 80
@00C@0 0 R 00 0 80080 ,
, H0 0 S
L qX Kh
-LM @`0 q_, 0
>6 PP , `* t0 S E6 PP
K, , 00 0 `P
,
` 0DP
@ : 0$ 0 10 Al, K/
-L M pP, K(K `P( 0, 00 00(00D 0S @ + l4 d
`,0(@@ D%+ 1 2 01( ,0 K X]^
-APL
@` + @p W 0P , " " P 800#
0 0 S
P 3 0#0#00C2 /4 ;
-L M4 `X PW P
0 S OX X 0 S"
p W BX X ' P
+ !1 W 1 @' T+
04 R 0 R#
@
o+ q W
0#$#p!A T
S 4 Q Q
@p @ @ p 0Z
TH D 0 0400 0LH0 0<00@0 0! @ H0 0 S 1 S > @ X 0!#4# 11 11 0 R! P 003/ 0P00
P PY }@0P 0<00@0000H0 0 3/ P
T
0+ 0<
00 +5 0
40
* 80
080+ 0 !
* 80 08080 R 08004 0 00 @@0@@0@0n$0 *
* 000 0 ^W U
X Y
0 (K(;
Q-L `@
0 G P D U`
0-80L @ DP * 1 T0 1
T0 K0h* 0
-L M<0 ` `Y @pP D Q
> d020 $ ?" P* 80$ 080 0`$`90 0* , @* Y! <
D Kⱡ 0 t@0 0v :0<0 0#K00Dp 8 ,0 i* DK o p * W$00$0$ `$` Z* $K
-` @ P L} P
0 U I *
- @0(@P@1L b} ) 1 T ʄ1 Q
@1 S @
10 S @ * ) 4 1 D
-@L` 0 P T
0 T
. V P
, \ ]V 0 @ UV @ 0, @P T U P P@
00 0k?0h0p p000K02 ` 00Y 00,qZ00 pX W
0p00r L W00r K V 00D00 pB W0000 P
/ z! 000p 200! 0D q 00 1j! 10 0 S
l0 l00l00 0 S0 0@00\0|0|0 S|0| 0|@0 1 R @@0g 1u D03/ ;! < Jv 0 0000 t0(0bL 00 n! l! j!
Ad! x M l M @0<
0 M D M @ Q! e (K0^ #^7^
Q/@00<
-L4M 08 p10K0Ai `P ` P Uc
@0〠p2 - @ PP P " J
X
! P @ Ph 0 P 0 PP/ 1 <0 ` @ 0 V *@0 0 S
00K+ PP 0 0 n`<0 X
<0 U @$ @ ` V
0 ɺ 0 ` N PP 0P 001 K0K 008 00 PP Q
0 KQ P `10[ S 80 D ^} V
0 ឺ T
P (K脽x P@.
0-|0L @ S
d 3/ 0|0d00
-L\M0at0 P0@ Sp . m @1 S
t0P L ST0 30
J ꌛD0h0 h (00,0>0#6000040>0#60@0>0#60 00800<000q P
ܡ 01p 0 X # 3 W R
l0 2/ p l0 左" } 嗡 WN / 0qLQ P
P 1#k p
~q( 0 / S +
Rx # xph0N ̀@0 c0 `1Hh <1d1 D1,0K4# p 7/x p Q
l8 0x0 W T1<cT0
81\K\0 <1X0 @1T0 D1P0 T! N pP h7 0 S
P W 0 .,1000`0 9`0 p0
p F l0
pw < 00l0 0 l0 u 0h0 * 0 0 $
0 P
+ + o P p 0 P _0
0
p W p W`0<`0 p W
9 p r p W00 P
20p 00
5 h0 0,0 3/h0 0 S
3/ h0 $p (0b S Wl p p
Xm (0 Xe l s0 03/4,K P000!l0p4 0 0 0
pP9
a 0 03/\ Wh
&K p0 S H!K L rr r4 P $h q H 堸 l P
p P
t0 S J h l \ l \\p0 啙(0 Pw l0DP~p 0~p @0 9/,K0 )0 03/ 3 0 00 0 0 D 块 pP\01
0 03/H 1 S
H h00q 00 S
l0 S E8 DJ 80l 8 J 0p l0 P
1 S
8 R
h S
2/ 00L1 h0 000 S
3/h0 01h !D03/t1 0 S
KZ mJ p0 S dhJ Hq h `10 S 0 \ K#0\0 0P0 0L0 L1 \K 00 oR d0&
,K000 帐 0( X N 0(0t000C0 ` \0 S
M L uq q 0 P (K x$N/4< ?^0< 8; 3
0-LM_OK@ P 0P K0
-LM0 0 K P
-L4M4 PAp1x0P0 l1 S
0B
J P
m ] \ 0 hI h1 S HpK l1 S@ 0 `0 S(
: S+
h!0 Y: P L0K z P P L R
0 p R L P
L p 0 E r P
Z
(c D K@ 01 tt 01帠010 l1 l!0
00 x 0!px
0 R ' P
[ l10
0 P P
L Fp 0 p 61 PA 5 0 p ,1 P7 l10
01 r l! 0 N 0! Z$ l10
p 0Gl" ! 03
0D K pA W K 01 t01 00C0 ? 0! t0! B y 0 0 X
m ' ] f z (K 0 H 2 X
m ]℡ P ( H a01 # 0 R001
d 0 0x000 | <0 0$0<00(00
-L M @ `p P Y / Q0QQQQQQQQx0 S'
% P @
t0 S
0
S
0 0Z 10 10$0 S 0 9 0 < V
D ` `0 t0 S
U
000 0d0 > R001
00x0 00 <0 00<00 0 W
PX < 0 P9 X <X P0h 9 y (K
- P0aL@ T
T
/$ 6$0(0 S 0C0 _ Y 4A 0 ( P0 S0 S /t B \ R R B 000\0 0 Q0\0x0D10 S 0 00 S0 0 0 /:
-LLMv0A P 0 T ps d0:d00 S ڒ 0K80)d0H 8f)
, K K P 0 0 000 t P 0P 0C0 ( ] 0 1111 K 0 t0 L0 S
K @1 S
$ 0 P0 F y 1 8 sc 0 80 H I % >̡尀180 S
3/ p0
Y S l0
00l0 0l0 10 T: X!
4< 0 Z 0T0 u T0 S
P\
t0 S \0 0\0 0 U 0`0 @ 0h
h P
3,Kx 000*\ P\
t0 S \0 0\0 0 Ux0` @0h 0
H P
X
` X Z l0 S R # P
p
p x t0 ^ t R
p" $ t0 p0 d " p0 x h ` $
V!
h P#+h @ T@" @\ P R
\ K \K L c1 t Q @< P `P < T T < 6 < X6 < <X 6 0 S
X < UX <0 O ! t R B R x >" f" R
0@ ~ @ x7 < 9 g e P
L - H $ C <" B/o0" S R<0p 40 00 p v (K/@00:
0-LM@ 0 s
S c T0 P0K` , 0 T P
X K K0
0-L`MP 0 @p0 0p KtK Sl0Kp0 S 0
Q
t K?o 2 Q 0 S
X l KK0
0-LRM@ 0P S 0K0 0 RQ/K 0S/KR?KL1 0?o2 Q 0 S
RK?o2 Q 0 S
K?o2 Q 0 S
QKK0
-h0PL; U @`h0P
0 P *- P h0 5h0 0 P
Kh
-LlM p0Ql p0 `+ @އ' 0 P
ps-. P
f P
h7 R
0`X # | @ ' Q P 0p0
0 P
| :s6 R
0;{ 0Ph0 | )s # @ ☍p 0 (1,!0$1` d6 0`0!80! !`00 ! t0 KB Y$ V
0 0
H 00 , P
Ǘ
@
4 P0 P0
^ ^8 @0 S 5 @ 5 @ (2l
<(20l0 0p d0h04 x0D1 00L0 E H d 40d 0d0@ p0p0< 7 < cz d4 R0. k/ h 00 ` K 0 p0 Y 0h 1 0 & `0 " "140 S
3/ 3 d 10 0 S
l0 l00l000 S0 l0@匀\0h p#l0 ho V 0ਂ S V` ` x0H1x0H1 Xx0 P1|0|0 S|0| 0|@02 R @@0[ 1u D03/h0
0 \ K␌0\0 0P0 0L0 `0 L1\K 00 I d2 Y Z 0 S @,2 0 S
Q P121 1 S
䑟 - 1 S
x p0
< Ji ` >
0 Z
d`
0 0t 0000( 000t0(0? `0 0ܠ Sx0 0 00 0l
h0 h00
0 \ K 0\0 0P0 0L0 L1 \K 00 XI H0 (K@.p8<^y^^^ #^7^: d@/ @04 $N
0 -LM 000 0 K
0 -LM 000 0 K
0 -LM 000 0 K
-LM 0
, R
? R 0 000 00 K
0- PL@ 0 T
P 0
-pAp1LQ l P@ h > `1<< S81 ʀ !` ``&!4 4 ! `! ` 0 00 , ! !0(0(22(2{? ? P
V 40 ? P? Ph1 S
-hsss
0-LM @0 0h0 00K0P0a PP
@ 6 t0$ $ 0 @0K0^/Q^
0-P @L T
0 3/ @0
-L @` P@
P
` P 0 0 S 0 @ 0 S N
0-8@L 0 S
R 2/0
0-0@L P
0 S !
0(00 S
R 0/ 0 /
- P`0@L Y? P ? 0<
0- P$@L F? K0h? 0< h q
- P`(0L@ T
0 3/ @ Zm
0-$0L@ T
0 3/ @0
-L Pp ` @P
p `E40 , R @@0@0 ^ 0 R 0 0
P0- qp P P`L P 0 0 @ T
0 S
0 Z 0 3/0@ T 0 S
T KhI 0 S
0 ( A 0 3/ @]@Z^^2^
0- PL@ J 0 T
0
0-(@L 3 000HQ^
0-x0x@L p @ RI ( (1$!xq H LPL r DD (@@ %0 v00 2K0hz /`fR ^D(^$ 0
s($ ( RT
0- @L0Qi(0 S 0t0d01d00 S 00C00 S K0hfT >0 S
$0 0(0000 K0hB
- `PL@P
101Hl 00 20 201D0 S
0 ! ! 0`1\0 X0 T 0 00 , ! !w Khhsss P
L1 S
4 /(00 S /
- PPL`
@ + PP h ! b D010Q V@
@ T Q /
- @0QLb 0 002D1 L^
-L 20C S 2 $" R
sD
-LM 0 0 0 a K w^C] -X` P𝤀 0 !`!800 , , !hsss
-`LP @w0F S U V
: V 0 00 0 0 0 0P0 宱 ^-0 00 0 /
- 0L @ `
1 C! S/ q 20 2娐 P U K P 0 S 0 W z ;c 9 U
Ec 00 Dc P$KkU|
0- 0L P
10 S1* 0 !` 0 !0h0 @d0 0@
0b P K0hc 0 @$ K0hc 0hsss| P / 0 0 1 ` o / /
0- L<@
1 C! S 0!o00 0 /]ȣZ
- 0ML< <0 4 000 F 0 K lQt^/
-@0pL P` 偫 0 @0 0/ p
0-L @ p P 0 ᗫ 0 0/ 00@-
P@ T pP@ Rt }O P T}Ϡ PT@ RH R? ? 0 0 0 0=@B x 0 /0= 0 9 @=
- 0ML (0( ( 0$ 10c 0 0 K Ԕ]Q^@=
- P 0$L P@c\H0 D 0 `pc Yp
8< $4; 0 R p !00000 00C 0 U
$Kk8=
-L)^=^F^N^
-@@L P0` S c P
Kh|Q
-LM00 P KQ P
K
0-L Pbn @P
n @P bn 0
0- @Lzo 0o K0hUn
-@40LP0`O| 0 ᴬ 0 `0X]W^
- PL`0K/ @
P5
0 P.
0 P'
PH1 S $| o P
H1 S | d 峫 m P
H1 S
| 4 妫 Khn ^3^^'^H=_^r^^
-0L PH!@ R`
{ l 劫 m P n P
@ Rn H1 S
{ r H=^^
p-L M ` PP P3 + P0 0 S 0 0 S U g7 P N 4 K)p P @
{ P
{ ` ج P H Ѭ 4 Ko 4 Kp 0 ʬ Kp萁|^^ ^^XL^ ^z^
-L M p0$PK,p (0 0`A<@0%0 S
V q P K
0-LM P , Ko P @
0 T
, KMo m P
, Ko T
0 S
: S
K P
P
m 5 K0
- @L`K/ P3 P- pP' PH1 S { 宪 m P
H1 S { h 塪 l P
H1 S z 8 唪 Khm p ^3^^'^H=^^
^
-0L PH!@ R`
z l w l P m P
@ ?m H1 S
z _ H= ^.^
-LM p PP P1 4 K+o ` @ T
z P z P
z P
z p ѫ @P X ʫ ` z P4 Kn @4 K
o ( 彫 V
* K?^XL^ ^z^
p-L$M` 0 P4 K<0 8 n P @
iz U
4 KYn <K P @ @4 Kn T
X Kp 0 0 00 /
0-LM @PYz P 0 0 >z P P K PK0
p-L M `P 4 Kn P @
$z V
4 Kn P @ @4 Kn Kp
p-L M `P 4 Kn P @
z V
4 Km P @ P@4 Krn Kp
0-PLM @[ 0 K 0 00 K0
0-LM @P P ~ P
0 K 0 00 K0
0 -LM 0 0l K 褏QQ
-PL @`8 h P
L P
Tp
y \ 9 `@ P庹 L1 S
T$
y & H=Q^]^^
-(0LT1 S
K hH=^
- PpL `@h 0 0(0p ` P@ t0@- @ P
^ P U P U P U 0 ^00 0@? 0
0-LM4 Prl @P
$0 0 0 >l K0耋QtQ
-LM ` @ F|P p0 S h0 0Y L0 R0@@@400,0 0 0 l KH=L=XQ
0p- @ P`ML 00 0 0 @ @2 奠 x 0@` h hh Ƹ 0P` 0` T TT 彸 @P
H ( @ 'Y 80 KphY ^=Q^>^^T=ԞQ@-`0 @ 0 @
0 00000@00C@0/@/0 L S
P
(( \ \ 41 /] 1>
0- PL@ -0 T
k0
0- @L T
t0 S l02 l0+ + |@0
p-L M 0@ T P
E 0 ` 0 Q 00 @ 00 0 0x0xPt1 0 0凭 h0 0@@ @@@0~ۡ 00 KphC]@//0u au Au >^pQu^
0-L8M ,0 0 @P |`!萟0 000(P$@ @ @P p 6E /0 ,0 0!0 000(P$@ @ @P p "E 00 ,0 0!P00(P0D0$@ @0 @P p0
E $K>HQy^"^xQ(^ 00 0 /
- 0L @0C S 0DP $ ` 㥐 ( Kh蠐 Kh@/
- L `0 0#@ T
0 P p W
0 Kh~Pp 80 S
TpP s0$ R @
@ T
Khg /@/h<0 0 0 P / //
-L P
t00C L 0 0#0 S
P P / / //
-@hPL ` T d P P
1@0@S@ @ @/
-XRL M0 L@ @b 0 R
* 0 j `@ 1 0 T
R 0
< 4 @ D0 8 4
0
\ 0<00@p0#pD
0- @L` |0QP S 0| 012 0 S K0h0 K0h&h@/
-0L @1P Qp`
0 V R 0
0 0l02l0 0C S 0 @ T
1 U
V t B R Q W
l "l B R @
-L M S40 Pp4
( ێ TTC " R ` Ȏ ` #@00 T
Y x R
d P
U
x Q
40 S
! W
\ P U Z @T@g /o" Y pp W Z T V Rx T
Rv
TN
T% Z
x P @$ @ ! ! kl l 00 0 00 0@` 0` ) %(| R | ! Q ppA R| | P@1 w
@ @ ( Z
(
( V
# Z ! R T
R
` Po
@@@ `@ (K@//h
-LM @1P` p1 @㇏K?o P2 0 S
`0 S 0 @ S 2 0 6/ @ P202 K@/
0-P0L @1P01 S
d0
D 0 S 0eD0 00 0
-`0`LQ0A@00 S
`b0 V
002 Khd
-0 @PLq0Q0@0
S
SD D41b T
B ` Y`0 <`0s X
; V
$Kk5 0 ٩ >0 >0T >
-`BLM P ^$ [ 2 RM 84! 08!1Q ` 1q @ ! A1 R !01 R0_ C01| AD03/ƴ 0 0 `0 SH`P1 p 0 R` #)41i ` ? P( 0( 1 !0# 0 Q P 0h0 ` Q?, 0,00 0000W nt0 `* x eH v 4" Kh^#^7^/>@/@04 -?[ B
0-80L 岞 0t0 @? 0 x0 0>0T b > 0 T 兩 >0 T 圩 >
p-L M@ ` P U P U P U
0 PK 0%۱ P o
Kp
Q-L @P&
Q
' Q
Q
" 00C S Q QԷQ Q `0 嬱 V ᨱ @0 婱 T 40 00C R 0 P
茽 0r
-L\M @P
| 0 p
Dx c \K @Ps U
Ul T0Ppl0 \0Xpl0 W@e P`1t0 hP W
U t0x l
SP1Z# 0q PK l0h 0l0 x0h X @ p0 d0 :`0 d0KL0 0 H0 0JL K$JJd$K<@ 8 q
LK DW P, p0 0 S @
P |0 0 R S @3@f 0 p 10$01l0
0 S
T! R X!0\1 0T1 0^ 00t1! U0t1 0[/0N000
-@ PLM /㤐 堐 圐 嘐 唐 吐 匐 刐 6h 0! 04 `" 08 p" 0< '# 0@ # 0D $ 0H $1 0% 0e< h&\0l00p0`~B p0 p dxB p0 p hrB p0 p l|lB p0 p phfB p0 p x0t0D1x00 ) 0 $ 0 ) 0 $ 0 0 "0 ; 0@( R- #0 Z/ / A< 00 0 ! R A1 1c h g V
h 쐄00t0h1t
= C1 k1d1 <[ C8000 0k 1 & ? Jp ? t R 01KJ00 4100 8100 <10 0 g KNg10 S 0B R S0 0 R*D* 0841010101 0 "& @0 "&0 c 0 ? 0`` !(0h1$A p0 p P0000(0 S 0400$ t0 l ? S Rp 0 S0i1t0j10 S
b 0 0& 0 A 0夀p` K S
đ堠 ȑ p̑ `Б ᬑ ᰑ ᴑ ḑ 쐔
쐄夠
娠
41 YV
p ` M$0 |01f0010 0 Sh00h0100 Uh00h01@ 1 0=l0
100 S
R 0% 00t 0B R S0 0 R| * = <0 KK(1 1<0 }%0110K 0 0
0X 00 K001010101<f 0 J` V
)؉ 0 R 0 J) 0 J K: 4ad ? ` ? A\ ? X ? AT ? P ! ? AL ? H " ? AD ? @ # ? A< ? 8 ? G<& p `0
K0P 0 S =9C
K =C0 0P20T2(K$]X]]]]]?B
-LDM@ Q X@ @ T0 @ x (Ko< @0 ST0@0 0H0 0 SP0 ^3
Z ^. 9>4 00
` ^& 040 9>`00 ^ @ 0 40 ?00 ; 9㦈 ~㢈 1@t`0 P V@0 D0 080 0L0 ?@A&K\p T 80 S
\0 A T
080 `0 p S @t0 S
5 0X 0 0 0ư P Z
C HQLQTQ`QtQQ Q Q,Qx 1 10$ P( vl0 P10 R
0 S
100 S v .K S R 0 娭 0 壭 0 娭 V P 0 垭 $p 80 S
0 0 S 0P P0@ 8 P80
<0 H0 X2 40P 00 R0 S*
R ~/ e< ~ r < 400C40 \0 00D X01X 4 p\0 W8 D00D0 H00hH0 L00L0 <0 S
p W00 8 p ZE0 @0 S
@ D00bT 0L R p L0T G=0 09 ᲇ ~ 㯇 : <0 S
0 S 40 9 ᚇ ~ 㗇 9 (K@/
-LM`@ p P> v01 0
. 0 S v
s v
+ l 0 0 00廯 @P
v
0 ] K@/
-L
` 0B<~ 00,(`$@ @@ @ 4 0 00 0!|>P0t> 0<( 40,(`$@ @ @ 4 ; $0 0!(>/.0 >0004 ,0 (` @ @ 4 0!= 0< 0400P,(`$@ @@ @ 4 0!=40< 0080P,(`$@ @@ @ 4 0!8=/ 00=8400
<00P,(`$@ @ @ 4 0!<04P0P,(`$@ @ @ E4 0!;0; 0/>@<08P4P0P,(`$@ @ @ -4 0 40 0!h; 0< 0800P,(`$@ @@ @ 4 0 40 0!:/.0:800< 0P0 ,(`$@ @ @ 3 0 40 0!:/ 0: 00<
8P00P,(`$@ @ @ 3 0 40 0!H: 0< 0800P,(`$@ @@ @ 3 0 40 0!9/098 00 <00P,(`$@ @ @ 3 0 40 0!t90p9 0/><08P0P,(`$@ @ @ 3 0 40 0!(9 0< 0800P,(`$@ @@ @ 3 0 40 0!8088 0/>@<00P,(`$@ @ @ k3 0 40 0!P8/.0L800< 8P0 0P,(`$@ @ @ R3 0 40 0!8 0< 0800P,(`$@ @@ @ ;3 0 40 0!7/ 078 00<
0P0,(`$@ @ @ "3 0 40 0!,7/0(7 00 <08P0P,(`$@ @ @ 3 0 40 0!6 0< 0800P,(`$@ @@ @ 2 0 40 0!l60d68 0/><00P,(`$@ @ @ 2 0 40 0!606 0/>@<08P0P,(`$@ @ @ 2 0 40 0!5 0< 0800P,(`$@ @@ @ 2 0 40 0!H5/.0@5800< 0P0 ,(`$@ @ @ 2 0 40 0!4/ 04 00<
8P00P,(`$@ @ @ w2 0 40 0!4 0< 0800P,(`$@ @@ @ `2 0 40 0!$4/0 48 00 <00P,(`$@ @ @ G2 0 40 0!303 0/><08P0P,(`$@ @ @ .2 0!3 0< 0804`0P,(`$@ @@ @ 2 0! 3038 0/>@<04`0P,(`$@ @ @ 2 0!2/.0200< 8P0 4`0P,(`$@ @ @ 1 0 40 0!t2 0< 0800P,(`$@ @@ @ 1 0 40 0!1/ 018 00<
0P0,(`$@ @ @ 1 0 40 0!1/01 00 <08P0P,(`$@ @ @ 1 0 40 0!T1 0< 0800P,(`$@ @@ @ 1 0 40 0!0008 0/><00P,(`$@ @ @ o1 0 40 0!`00\0 0/>@<08P d^0m^,Qu^v^8L$Q~^4R^^^R5 _+ _^^^^^^^^^^^^Q^^0P,(`$@ @ @ 61 0 00 0!L0 L 0/> 040,(`$@ @ @P 1 0 00 0!0 0/> 040,(`$@ @ @P 1 0 00 0!0 4,0/>(` 0$@ @ @P0 0 (K
- @ TA$ " V
? P
)@ 0 S
!|0 T@ V `)@0 P U
`0 S P e )@ `) T@D @ 0 ɡ V 1 T@ O/@0
-pa0QL @ 0 S
S,
S8 T
P U5
@ *`. T
P#
` P U"
@ T` |P T ~ `0 P U
`0 S P @` @ V 0 b0 P @ @` T
/@0
p-LM `P V
0A @ , KXY , KmKp
- pLDM@ h `l0 w/ %K/%K< $K.N$Kp WA
e0 Y
# Y X *$K 0$K#K (2K
< K\5 #KD@RP S RCK *#K R 0#K$K P0@ P Y X K KK K m@4q PK%K 0K K 0Dp @@ .P&K0 0d %KTP T0P 2"0T &KW\0X K2"0\ &KV V
K 0V K 0V h0 S
0
Vh0 0
Vh0 l0 S
$K0
L0H 2"0L &KVKKD 0Vl04 K 0Vl0 0 S$K p(K@B 0@- @@P@0 0 0 S @ P=9C@ =C0!A@PA0 0X 0 S @ P=9CA =C0 0 $ R 0$0X S 0?B
0-P@L T
0P 0 0bP0 T00T04A0
p- qL M P@`
Q W<X !X @0 GX < X Kp
-L\M@l K 0 P X l KK
-1L x p @0А0 @@ WPᤠ0
S 00
` T P@ W P @ U
@z ;z P @ 1 U
1z 0 [Q
- @TpT`L _Q P P
z P S U@0
0- @@ L0 S P @0 R
K0h000 @PK0h0
- RL M P`@ S R@r׀ S R Q P
P 0 P~ `F@ Vm RRRRRLR$RRRTR S R ā W S R ā S R āЀD0 Y X: Q P < 0 (0 0! 0 0 0 # Y X&
D bh0b hl 0 v\ S R ā
t p S R ā S R ā@ p @ I (K8 -
-LM Q `@\ 0H SX PPE UT p WQ K u PL 0 u 0P; 0 S
0K ` 0 V pK @ V X0\p \
0K 0 0 U 0P 0 0 00 @ 00 0
0 ) 0/o" P R 0 0 0 L 0 (K
0-LM0 P @ $K X P $0K 0 K0
- @L@@` tPpĀ 0 U
$Kkx
-LM Q ` P U K Pz 0 @P
j q 唊 Y P
@ @0 Ϡ @PR 0@0@ 0 -0+ i0K` U 0 `00 00 0
0\P ( 0 @?o2 P0 S* 0 P0 垠 @P! Q P ` @ PP ʍ PK0H
0- @L!. m 0 K0hC 0
0-@ PL ,T h00l00p0000@-A@ b P \ l \ RA@ P0 0@@_@ \ @_ RA " 0" 0 0
- P `! Y Q 1 a 0 R bL @ @ f R bp0 @ @ @ p-, " p !0/
0-$@L0 S P P000H0
- @L$M,K,K@*@)8 0 42 DR U
RHD" p * 8 0 @ P P8P 0P d``\ <` Vn
0@ S<0 08 UH0 0D0 p0 " T#UP
P! @Q l0 S6 > @0 Z P@0
x p(
'}`p W 1,# @ Sx0@ 0 Wx0 p )
>
P
Dp08 E
-L `p
@Pd !A T 0 D j @ 4 @ `A T
o00
p-QLtMP
, @ x K x K,x KxK K KV `P
` X00 S
L [,0< S;# Kp^@L^H00
-5L M Q`P-
4 Q
4 Q
4 Q1 8 4 Q
4 4 Q
4 V% 4 00 0 P"
4
00 0 P
0\D 0 0 0P@ 0 0 o 3 V
3 V
3 V
3 V j 3 Vu
3 V C ,b` 3 V
|3 V,
t h`\ 0 S
S @ 4C ,b 0 V Sp p `0C@ V W@3 @# * p ` p 0 S
SB ,b 0 V S `0Cp@ V X@3 @# *, O 00,p080 0X00`00 `S ` V
% @P F A j,b V @b % @P p, N 00,08000X040`080% `PA G0,b S
V
l 0 R `x@2 ` V
% @P g" R @ TU P @
A R+#0 S@1@!h 0 X H IL @ @ @ KiRjR @hR eR@lR 0 ,p(`$@@ @ \$ 0 0 0!1 0'> 0,p0(`$@@ @ H$ 0 0 0!1 0'> 0,p0(`$@@ @ 4$ 0!H1 0'> 00,p(`$@@ @ $ 1 0 0!0 0'> 0,p0(`$@@ @ $ 0!0崠 0'> 00,p(`$@@ @ # 0!l0,p0'>(` 0$@ @ @0 # (K^V^pMc^r^^ N^^^
0-@0L P4@ T K T0 020 00蜽pM
-LM0 @ S @1 T p WG $Q 0@z>0 Yo P @0E P ` R>) 0, Q(p r^ P,50 S( 00`rNO 0 0` h0
0 0` L0v 0 0` 00
0 0` Kt^^^^
- PLp ` Q @0 T
0 0aX00X0 Q0 0T0? T0;0D1 Q > PP 00 0(2 S$00$0 0 T @ń> W 0 T 40 T T Khp:
0-L k 00 Q B (" R$ B$ @? P ; @! T@ R A" 4 P Q 0a0?o" RB 0 / /(` 0L \ S000X0 S$0 7Ó 7 Q$0
0 \0 S\
0 S \ \ 0 R 00$07$0 0`0X0U=
0-X0L P 0 Q
0? S0;0C1 @ = 0 0T00 0p:
0-L 00 R
m 000 @@f 0 0 / ⱄ ^
-L 20C S 2 $" R
-LM,0 0 S 0W 0 0n K |w^ؔ]
0- @L -K 0 00- /
-L MX1 Q @Q<0
000 080 0 `40 040 0`8 00 20 2 00
Z p
V0* 0 S' 00 U 6 p 6 40 ў W
@ 6 @ pD0 8
6 X
00 U p<0(Koq|
-0L @q0 0 S7 P pp0 g Y
U)
P 6 ` P W V 0$ V
` X / 0 /0 X / 0 $Kk7 |
-X0 Q `Q ppP 0LP @ ] P/
- PL/ @ I T @%
A ` N6 T
@ 66 p X
$0" S - T ` 0 $Kk6 16
- `L0 @LQP0 S
T @x/ <0 0 S P / 0 / / /|<0 0 S
P /(0 0 `o / /|,0 0 S P / 00 / /|0 0 /]Ӆ
- 0ML< <0 4 000 Z} 0 K 6Rt-^X3
0-00PL ~ @0 00X3 C
0-L @ C P 0 ~ 0 0X3d0!001< h
P
d Q 00@ 0!!3 / /
0 S " 0"( ,00 /
Q0-L@
008 P 0 S(0101!1 0 R0 0
0- @DPL 1 T0 1
T0 K0h
0- P<0L10A 0D@ 0 0 10 Q 0
0- PL@ 0 T
0
- P`@L T
(0 S $0 (`00C0 4A
- L H 0@- 00C" 0! 30 0
\
!@A T @ Q @ P 00 0 0 R 0000 # 0 0 c0?o 0s 0 c 0o 0` ! / /
-HAL P Tp`
0$04$00F" 0!!3
(0 S
l @ X X
t0> S 0?0 3/(00C S( ;R;R;RD| \3
- PLPp @ U+
0 "G0 p0# 0 S 0 P
@ T 0 Y00 ` U0 0
0 `VG ` P
0- @̠
T P 00000
- @LJP`@ T
o 4A
p-L M ` P @K`$ @ `Kp
- @LMYHP 0 (q40 00 ,0 (0 L ` "
㌑$`K` 0@ \$0(0,0004 ` $pK`' 8p 4K `0aa
8aa`02 Sb0!!!!!!!! $K]
p-LM `P0A<+,Kq? 41($ 0 `L K PC0 U@0 00<0 x00 40 <00 ,P P ( 0$0 D d0 LK 8 : Kp
0-d0 L1d00t0 000 @00d0
K0h蒑0
-T1L pQ0At0 S d0 S 2d0( %0 S` V
0 {4a - d0 S ` @ P 0 S d0 S t0 S
d0 S 0 0C00 (0 $Kk3/
-pL ` w0 @ T
`0 S @P0 U V
| Kh.- _d0 S 0 S P` dP%^ PX U
/@03
0-L0M @0 P D KB0 D0 8P 4DK p rK0
0-d0L @60# R 00 SP
40 1 P
Q
Q
R
F K0hF
-P`p @L T
W
l0
|@
p-L4M @`P0 L K]B0 L0 LK0 @` Kp011 0/
-LML1 `,00Q 4 @Fr @1 0DH o \ h,0 4)
2kODq02 0 SC
& P?
1d ^
0 (Ko / 0 S0
0 (Ko Q ^
@ 80 4 s804 qq 1011010@00@2 0 (Ko(K/$N
-L$M `0Q H0J S
2< < 8 8 4 4 00000 <0@
80< 408 040 D 00000 @P *$0 4$0#Y D 2 ! h
0 ]v
l T
X0 > @1 0 S 3/ P
@PX
H02 S
S
! x0 Sڈ01
h l 0 $ >@d0 1d0! @ ᔁ(K3]
-P @0 H`L{p@ c"001001 0010010
E 2 1! U
( ! 02 $Kk{]
0- @P0Lx ( { x y K0hL^E^
-LM0A Pd0p
g$0 8$0` S ؾ
K $z !%
:d0$` V
H V$0 8$0 ? 7$0 p4a0 S
0 00嘎 A00C0 .0 00 L@0 X`qd1%
0 3/0 ` S
P
sk? V0
`x d z Tx z Vd02d0d0 :d0 c^m^] ].]
-L4Mt1 `Ap!0Q唁 R H0p!u2k X02 1 S
`1 P
0 \ K?PK 1儁00 \Ko P \KJ 0\K 렀 0 S
P
1d Z
\0K :/ 0 S
\0K A Y \K ^(K$N
0-x0L !@0!H " R
<_R<_RX_RX_R<0 0 S
K0h/K0h$ x Mw^
0- Ppt0d0L1d0 >`0 S 00C0@ T
H(0 S 0 S V
$0
` (p000 .4A
0-\0L P10A 0x0 Sh03h0
> `dQ K0h$ t0 l ? S Rp 0 S /
-L @`
p P U
W 0P00 P`0
R 00 @` 00 0 / 0 Q0 S / S 0 0 0!< 0`4 0 , ! /hsss
- `@ LP @A @ T 0 0 /
- 0@ R000 L 0$ 0 0 $ 00 ( Q (RR
0( Kh:t0\ 0 b`00`00 ` ( q0 0 (0P9 KhD@p:
0-LLA 0 ( < 0 0\0K0h0 p:
-x1xaLQ 0 Sp
f W=
$0 G$ 40$0@ 2
X P-
; T pp W
$@冇@ D
0q B @P
01
W @P
01H B0 @@ 0 S
' X
_( X @ z( P
#@ $N]
- P@`p L Q
0Ȁ S -@T $Kk
0-P@ L U
K0h0
0- @LP R0 U
0 S K0h K0h蹷
- L @`Q` U ʀ 0 !`` 0 X T ! T V
] hsss 0 t 0| x R
0- PL@ 0 T
=0\ ` P / 0 !`8 0 0 , , ! /hsss 0!< 0`4 0 , ! /hsss
- P`L @ T
0 SP 00:#00 3/0:#0$. 0.! 0!X@
-pP0LA b P 000 (p
-L M p `Px @0 Y *0 P Y Kv 0C# z?@d
l 0 \ P0 H
x 0'#p qaQ (KM^hoR
- P0L` 0 P
\ x0 0 S
0h 릇 000J
0 8 0 0 @ KhV -rR^M # 0# /
-P @ L b 0 0XP (0 ' Kh2
-x@ P$ML40 `@0000 0p 000p 00 00 000000 00嘲 P
mv 0d 0
0 mv x0P 0l 0d
0 ]v @ 80P 0 04 " (Ko^PiR^^^^
-QL ` tA R
@D 4 0 K, @P v 1@ p0 g `| 0 b v 0 o0 j0p V
T Pz? z <x 0P S * 0 R SB" $Kk| 00 | M ^Ԕ] _2^i(^0_(Y 80! 0 R ᔆ 0 d! /
-x0L `P@0
p
0* @X @ R X Kh Q
Z 0 M
-P L0
x
su 6^
-L M0A P `p(000 p0倐40 0p01@0(20 S
00 00
000
00 40(p0(Ko / / / /
0- P$@L 0< N 0/ / / /N /- / / / /
-LM K ! K Ao K
-L 0KM# KqAo K
Q0-L @
@ P
0 P
0
0 0F^M^
0-L @6 P
K0h K0h9
-LM @Q `00 T ,W9 P T O9 P dpD0 40 P
@P
40 a0C Q Ɨ @Pd
-D PZ 3D F PP t D P, l RD P' D IBAA0B Z D 4 ʡ%<$ 0ሑ
K 6 *:
& 0K C C 4 %<0$ 6 p *:
& 0 0 0 C P 00 40[0(K菿^^S^x^
0-LM P `s , K=8 P @&
C P C P C p Ks C P C t As U C P C H 6s , K7 , K8 늀 U
$ ,s *s K0]^x^i^XL^s^y^
- ` LuMg?K = 0 S
E P _ $4 << 1 0 :1G P 8 `P
L 0 S< 0 0B( PP#
<| I8 P 0 S V v \< 0 4C P
?C S
#
<2 S , 00 0v l 0 P S V+{ 00 0 11 0CBAA0B1 E Z0
0191 0
r V
C r B P t /C P a` r \ r X r _Kv|?o V2 0 S
B _K _Kh5 P P@,0K0P!S* R P!C_Ki?K p @P
@P
i?K
_Ke @P @P
B P2 t B P- Pl
\r U
B T
Ur D
Sr _K1| P( U9
1( # 4!& 60⨁ 1 k?K 0 ? . oKЀ gK 0 X _K7 P
g?K _K P P
PP g K A @9 ) 89 0 S
D Q
1 ! [7 P!1
h0숟q _K{ P I7 P P _KA7 P P _K87 P b P d_K07 P `(8 _K' 0P
D R 8q 8 0 S
D R
1 q 1h0 q 7 O t7 @ TZ V
B D P A P( P &B P# A @ A 1?4(< 1 4̆,1 q?K 0 ? sK A @ A $ ? 4(<1 481 u?K 0 ?\wKЀ T 0 : 2 @P
A P4
A P A P A P 셟 0 C @P .q ? _K7 0#*0*_K"&&"(? 0%q _K @P _ Kq $ @5 @dA @ P iA `s ZA P A P 4 ": :#60as p 00 04|4 ``
U* 4 P(
<6 P
0 pT Q P
1C @P
_K_7 _K!**"&&"(? 0,$q _K PPW u A P =A P eK5 P U
@ Pp .A P
I @P
`0 K `!Q `P zA X 5 PeKm5 UA
@ \C `P: @ @ @ pƟ 4&< 06 $hb$:0 `& 0 B 5D <2 @ (s @ P ( @ P ": :#60as 0 D s (K8p 0 0c P @ C 0P 1 @ @ 1 8$ #,41 ! y?K 0 ( ?({KЀ 0 eK4 0K PpO p0` p $& `M@ P J@ 10ßk/K!# 0| | 0 ` 0 Pr JC^ ^X' _(N8'p9^^x^hZ^^^^^ t^P'@'^^^^BZ^^XL^y^^^^s)^4^H'zd@Q^V^]c^$ t0 l ? S Rp 0 S / /
0-L @ 0 P K0h0
0-(0L @ SP |0xP S0P x|0 S0 K0h
0-(0L @ SPt tP K0h 嵾
-L p |^
0- PL@ d0 T
ᢾ0
-L `P? @Pp
(2(p 2(2g @(2(p2(20 h1$00$0} P0 0 S D0 P
80 0 S , 0 `o /ှ|\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
0-p@ML dD \P\0 0@ 0I D0 0 0I ,0 0 0I K0:^^^^^
-L `@p P 0Q0l0&4 0
᯽ A
ͮ 80 $,Ko [ 4
-L `PpR P
H 0A0l0&4 0
z
ᘮH0 p 屽% @ e 4
-L p`P P
,Ko0 UA
Ꮍ0l0$4 0`
@
^80 6 M U @
. 4
-T0L @ 0 S 4 00P` 0 Kh耾4
-<0L1 " R ( R
$0 r 0! 20 2 /$0@- #``p S Rc # 0#@# 0D@VP U T#C R 0##D R0#
- @LM4K 2 ` S
(r@p
(2
p 0 WR2 P U
0 P(0(22(2 p 堼(0 T0C?o2 0 S
$0 0(0
0(0 ᩭ 0 S
(2 S@ U " P W@ 0P"$2 R
). 22 UX
0 S 00) 0)(2 2(21崁0C1- 0-0 S W x0 S` 00 S
0 03/
Y V`0 S
t P ݤ V[ U
x 101 000 S
P 000Eq @q T $K PN
0-$0LA 0 l0K0h-
0-40LA 0 l0) 0)K0h
- hqhLA凯$b V"
(0 S $0
0$2* 2 S
$ 0$1 ("@ $20 0 P S 0 S ( 0(0 S
P h0 , 0, + 2 0 2 20C 2:TNUNVNWN
-,0L1 @ P $2 S
-LM p P$`K | tD e0 S
{0(0(2 @2(2 @ @ (22(2 @吻- 0-0 S 0 SP \00 S
P0 03/
`V UP0 S
` l PN
-( L @ R0Q
R
R
l h0
>0 S
J000 $08$00$ 00庀0 S
0 (0 Khr(RR 0( `
N$ 0 (0P 0 Khg^
- aLq Ժ 1 @ T/
`0 S @ ɺ`00" t R
B R 00t0P U
1 U
F$ 38$0(0 S
04Q ,@ 固 } Kh/@0
-L M2"R rВ X2 10 100 S 00z2~ Kp$N
R S-L M p`P 0( K P ` V(@DT0 P @ K
p-L@ M PP
|@0 ` 0 S
0 y Kph} Kp$N
Q0-L@
0 R_ S T`0 00`0 P
0 0
-LM@0 0`4SD 1 QK 0 sH Y 0 0
0 03{ P< 0p 3 P R0 0 0
P R0 0p $
8 0p
0 R
ki V
PK P0 K X P <0 S 00 00 ? [0 B R R
AA0 B P Q _ R- R 0 S 0
8`LP00 40 V0 p(
) 40 0 0 Z
0 R
0 0 0 00U K0 u. P
0 `` R000 ` d0 S
P Q ( S
( S Y
D0 S 60 S 6 0< ; S
;0
0 S R 00C S R\RlR(RHR8R
\0 S0 0\0 } 00 Uy \0 Sv X0 Ss T0 Sp n 0pj H UF Y D0 SU \ P_
+p; [ \0 S V
㘮 PP
\`0K* pP
? W
D \ j8F R* " ; 0p7 Up3 U Y. D0 S+
) \p `gp剮p W
[
` PP
\ Q .
0 8 `P
2 D0 S 0 Y0 D0 S 0 Y0 p P
pP0 S
\0 S R0 0 U 00 S
Y`p P
80 S ; P `
U
= 800 0 s P3` 0 4 S * P00 0
04`00 V4 0P0 '
`8 0 .0 0` . 00`0 Q *8 P@ R `00 R*8 P08 080 U
4 0 R `
0
`40K 040F0 @p000 4
0 U0 4 .
;0P
0B `0 0 0``@`0 c0 -
3.0P@4 Q8 R `` 0 R*8! P`0 R
0 S
S\0[00
S \000 %K# \ ; 00 D0H0 080P0 S@0( S( P00 0 0 00 (K^X^ b
-LMP 0 `4S
$:g Q 0 s 0 S 0 0 0 0
x P 0p P R0 0p
2 0p
V
K 0 K @P ` K-08p40 [d0`
T
P R
1 ! O, P !1 S
T p S
@```
0
R 4 RB ` P`
0 P
000
0
X P
٬ 0X0`p K-4 0B T! * d8 ` B
,480H T *00 S
@` 8004 Q*8 P0`(` )-P`4@@D T4@ 8 堬0@8@P0 SP(00 V(0P` 0 K 00 (KE^X
-L Mp8 P@4S
]f T P 0 S00 S X `` X U
0 0
w P
00
0p `` V
} 0 0
w P
u 00`0` S@ )80 S U
@ 08 Y 01 - P
Z 0@00C S; lRRlRlR@R T4 0- K P-0[ 0C T) 0 0 P T @! ګ pP ,
0 PP
! 0PS PP Y P U
T
,0 Y
d Q, Ϋ (K舖]m^
p-@PL M P0
|@0 ` 0 S
0 E Kph| Kp$N
-LM0 00 0p`$R
e 0 S Q 0 s g PP
0 W8@ 00 @
0K 0 0K Z 0P 4 R4
V 4 0
0 0
v 0P ` \ \
0 S QK
` C$d0 SH 3 0H 0 VM 0M 0o 40 X0070 0 p40 S! 0 se 00 "4e + +X Ph 00 0 Z 0(00000C0
00 e 00 ss
?o 2 r 0 S p
0n ( S0j P Q0 0p _
p ]
X0 SY ֪ pPV
0K 0 ;4 & 0P0
0I ê P @ +0 70 4 ֪X P
Ѫ 0 R( 00 0
Tv P
0K?. { P
+ 8+ R:
0P 00c0 00C0
0p`@c0 0 0 嚪0 (K^X
P 0-L+@0@@@P p T *0 3/ K0hzXNX _ !_\N 0< 0 /X
P -L
K h 0!(20(2 XN0 1(XN
XN
-LMp 0 S1 004 S 0 0 X X
@ 04S
T!d N ``8P U 00 S @ > Y 40 0?"' 000 ' 40 0
0 0 0
u P
' 0 0 S
00000 00 S:
R0
0000 00`@00 S8P P X 0 @ S `(KX^
-L$M` P Qp
04S
c - 00K 0 0 s H@ T' P"
P/ 00 V+ 1 S( 0 S RR R$RRu P, 0 0 S
000@ 00 0X0Kl @ V
X K6v T
@ T 0 S
X W 3 # K$N
-LMp 0 4SP`@
c 3 T 1
0`0S0 V0 S) `0 K P# U
- 0 0 K0K p P 0Hp W
0 0 @ `0`0 0
0 7/ (K^
-LtMP 0$R p @`
b m 0 S j Qg 0 sd 00 0K 0K PZ d0 S V@
" ( P S
P Q ( SF 011H R@
,0Kd # d p pB! N P@0p 4@800 p`04 R# 80 S
P @D R T 0`00 0 S
X_ Y `0 | P `` Y i`Ip 0 X (K^
-LWMd1 0 R` p h1
` V @b v `d1 S 0d! 0 Qn 0 404`1 S,0\1 0X1 XQ YX
\1 \! P,0K 1 u Q
0 s Kl1 P @l1? N ?@E @C u PP PE, K ! 1(0 W 0 @ @ @
W
W
W$ h100 00K 꼀 h1开 0 $00 @`p0@ @ 0 SK,0KV/K(a# Pq @P
K(a XT1pK0 @` p>K K P @ 0K ' P D0 R 0 s R P `1 R SP Pd1 SP U
,0KV/K(a#S K S @P 0 TXA 4 \ 8`0`p` W
RX1 `1 RX STa
p| P U ^ PPx
@ Y P uo @ '00 0`1 p P 0 Q P R0 00 p P R0 Q
P0 S` =a L
P0G/Kp S0`1 0 R ! h! 0P∐`1
h! '`1! ( - X`1 00 0 0 R 0 W0C 0GK q 00C 0 ! 01 QB ( d1 ST1d! 00 S$
TQX0 S 0X0
#` ͦ pP
' 0Xp7 0 T
K8 ` ` @(K$^@^o^^^
--L0M0 00 @ T? p
0 0$ K!0 s j $0KPD #pK K W @P
Q T R `K `开 '40 $0K 0 $0K@# @`p )B P @2 84P @ \
0` ` V P 0 P S0
X P
X00 S -# < PP
0 X,'0 XP' $K
- `L$ 1 V` 04S8@P`p
$` 6 `0# `@4 8`0D" S *` Q0 Q
8P@P T 8 P
00 S`@ 0 P
0 P
0400080P0 S V $KkXNX^
- P @0 L _ pa0 W t0
T
t @h _ T @
P _ @ @ _ @ 0 @D_ p` Kh_ ^4^^ۛ^@]=^
-LM PJ
@ TG
匐K` 2& 0 S3 P ! 0 0` PqF1d 0 40 00 0K 0 0K= P 010
P,0Kd # ` P 0` ` w u 0 0+(KXN
-L$M` PS 00 p00 ,@K4 00 0 00
0p0 m @?o V2 0 S
0@ X @3 @# U00 0(K
-pL\ `@P _ 0 W S
T
@00 R01 )@0 0- C^@- Q @ pp p w @(- /0 R
0 / 0@-@ 0 U T 0 @ 0 0 0 / ʚ; 0 /@B 0 /pP
0- @ P 0L 3/0 c0 0
0-h0L @P \
0 R @ ! Q P @$ 0 3/ 0 3/@0
0- @P p`DML!l10p,`0(P00K$@ @@ @P +00 SG
4p0`0 ,0 0!1 000(P0$@ @ @ 004p0`0 ,0@0$0 0'!0 000(P0 @ @ 004p0`0 ,0\0(P$@ 0 0!H0@ @00 0 0 (KX^HRd^Rk^tPt^
-LMtQ@K `@ 0 0K` $@p0
0 0 00 00\@ Lp 000oᨂ P X4 ~ P.
0 S 0 R
0 o P
p W
:# `P$p 0 3/ 0 3/@p @ 0 S ( (KxP
-LM0 S @ Q = Ь
P0 p` @?o T2 0 S)
VpP"
! 0 K00 00pb^ Z 0h 0
Kp H 夬 0 S0@`Ppc$@ ٬
P(KxPpP@^^^
-L,M pH`T@P0PpD0 V P J$ 0 P S@p
03/@ ! %<# Q P " 0 S
3/.0 Q P 0 W
P0 W(K
- @LM$ K$ KK
- @LM$ K$ KK
0- @L K0hP
- @LM$ K$ KK
- @LM$ K$ KK 0@-(PP@ 0 T
P0 T0
- `,pL@PP s U
P0 U
- `,pL@PP j U
P0 U 0@-4PP@ 0 T
P0 T 0@7P 0@-(PP@@0 T
P0 T0 0@-(PP@00 T
P0 T0
-LM @a 0 ! 0
*1 P 0 P 0 S
0 0 0] ] S
0 0 ] P 0 @$ P R 0 R ! S R 0 3/ 0 3/@G( Khꜽ0^^9^pPxP
c0 - 0L K h5 P
-L P嶪!@ 0 S
S
$ $0 $ S P` 0 p000 0٪ 0 am m 厪0 @ T
"?o2 U0 S$A ê T
D0 0 ) 0 ( xPpP/rR /-^ 00 0 /
- @L8M [4 Kj` ? !,0K R Y X `V pxP#K`Vp4 K7a 0 S
DK4 K?00 0 <0 0$K\ $KxP KpP6^1@- P#
0 P4 :0 P3 0 P|0!
, 0 P
0 P
0 P-@" $ |@0@@ @ 0 0 $0Hp0 @ @ 1(@1 1@1(101|0 :0|0|0 0|0 /
-L0 @PLP0 P0 ! ` p P0 R 00
- LTM @Px l0
3` PpP0 W 0 Q
P Q S R Q U$0 0d0 0P`(`0 Hp 0d0 0``8`0 Lpl00 S
S
S Xh 0 R
0`0z \PK 0 %K'K!X (0K 0 K Q P%K %K 0%Kx >l0 ' x0LK &Kx0 $KR S RK *$K R 0$K$KK R 0$K%K R 0 %K 0%K 0 %K R \aH Z
P N @囡 0 $ R
^
Q 0 ͡ FH # 6 Q0 W T(
T , 0 p, tpppl x 0x !a | 0 @@D 0 T`pp pXpp ,@K 4$ 畡 7e(KPP
-LM 0 p K @
-L M pY P
` Y `PPܐ!0 0 S Yq
01 S l Y
& 0A T, U Q|F P ( G R0p@夠pp@@ @0 @0 W RR R R , Q@ PϠPT Q PX $0 H
W
W < KX < K#K 4 X00X X0 S H X = U
oG (KPPɚ; 6e
-L(M P p U` @0 T 0 S DK bc P
LK LP H0 P T
D K C $K
-@L P T`
Ts V`
` p 4" \ 0 \ 0 0 S0 S= `pqU 0 \
X0 `p ^ 1`e p6 X% 0% ^X 0%h10X0 0 0 S 0 @ S
eX R 1#e( 6, 0X RX X R 0 0 `$ V
0 S
h 0 S 0 S
0 S
0 S 0( +( $KkF $Kk"Pɚ; 6eĨQ
0-01L @0P S%
ϟ01@ T
U
P U
h0 0 P @ T
40 0 P K0h0P0@-8P@ T0 R 0 0 0
- PL` @ ፟0 V
˟
-2LQ 0@ }P P``` Qo
0 0 b RG R RC RC #
R RC RC #
R RC400< RC80#<<<
010R 0 RC400< RC80#<<<
01
" 0"0 p0 00 Z 7/ P R
P 0 0 0$KkD
-0 L @pP
0 a R 0 d00`0 0d0 @d@ $Kk ` U0
0 0 0 a P
`0 0 00d00`0 0d0 @ d@
- L|80 ` ` d +h Rhl00 R
-LM@ ` T
8 @ [0-` `0d0( h0 000 S 0 P "P ](p 10l "P 4P pL0x* 0D P P(0@ m* @ KS r^^ ^^ 00 , 0 !$00 /R 0 0 /
-L @Pp` p ` Kh1
0-LP @ K0h%
0- @L0 0 0#Q000P T @S 0
- @L Mpq 0 # 0 0000aP0 T, 0 V)
W
0 . 00 0$ 0$l 000 p ݝ W
0 T0T p 2 p X
(K ^
-L @`P ` P Kh
0- @L@$A@ 0
0- @L 0 @ @ݝ 0
0- @L@ԝ@@ 0
0- @L@ɝA@ 0
0- @L000K0h躝
-1L@ p0`P0 0!h
\
d hdl Pldhl P@ C hȑ,
! \
d hȑdlȑ Plȑdh(l( P* C !*h
\
d hdl Pldhl P #` p P8
003/ P T P1
V w H (P p` Y
P
P Y
b 0, R ,P(p 0 0 ( W (p Y
L 0 R
E p @ P $2 S
;%^
-L M PQ?000 ,0 @ Sp`&
0Q, Z R
T0 P 00 0 0 ( Q Z X
V 0 `F00 (Ko;
-L ߛ @M ,^ 0 R
uL /x>^
0-LM P R
2/ P1 0 <0 ? ( 0 S $
$K3/ @P 0[0C S 0[0C S0[ S0[; S0[< S$ KNL00@ <0 P 0 K0落
-L4MKP0 0 0TK N%K P 0
lL 0d"#K 010K 0< K4K3K00K/0KLK4R P 0 S %K<K @PcKw? R0 K @+ %K V%K/ P!g? R00 0 S %K V0! 0 0xK ` 0`M `@ 0 <K V
X44K %K#K 040 00#K$K?4 Q`qD0 ` W ʀ 0! `! 0 !L KT 0!!`q0 !@ \ K (K f . c^ x^^Q ^^^8^hsssX^
-LMP @ U
,K 0 <0"K R?"K 5/ 0 S
`P0 <0`V 80 R ` p, K L 0,K 3/ K落
-LMH@0 S
$ K"K0
P
$K P
$K Kx|^
- p P L0 0a @ T
0 W @ U
m4 U f4 P e V ` $s
-LDM 1Q 0 @ P @ 1* pl0 d!(0 0 40K0,p$@ @@ @ ` y 0!14 K0,00K(p$@ @ @@ f 0!04 K0,00K(p$@ @ @@ U 0!04 K0,00K(p$@ @ @@ D 0!T0,(p0$@ @ @@00K4 K 3(Kx$s^hS^^^^
- `p @LM0 P Pㄡ @K` L0K\0 0/Y;h0\
0 0 0@ 0 000 00 0 0 @ T (K蘖]
0-@L K0h
0-@L K0hu
- @pL@dP `j Q P0 0 T 00 S
dz ` 4! M!Ѝ / 0M000 4 Ѝ /
0-LMP0E S # * @R$ K21[ :#:91K 0[$ K@0<< 0K\ P @ UK0
0-PLPE U @20T :#:90D0T@0<<0D 0
-L(M0$00 0
0 0 00 00
00 0 000000 0 0 nJ K ^
-L(M &4 K4K I K YL^
-L M @K ! q 0 "$ "$ @ RK
0-P @LM KR0 000K00K1[000K00K1[0000 @ S K0
0-LMP @ Kb8"8#4b4#0! ) . +000 P U K0
0- P@LM K
b8"8#4b4# 0 000 P S K0
- 0ML0 0 @
Z 0P
K 5` PK
9K
-L M@01 ` kk$ N uPp U 0B03/0R PP 0B0 3/ 0R 0
(K
-L M@01 ` kk$ N uPp U 0B03/0R N PP 0B0 3/ 0R 0 K
(K /h0 S /011t0?a Q /00/
0- PL@ 0 T
ɗ0
- @0 ` pL !DM,PK@%(0 000,$@ @a@ @ 00 S)
0
40 0 00,(00$@0a0@ @ \0,(0P0$@ @00a0 @ 0 (K^=k_l^ #S^
-LMp0 @ 0PP` ? ? |0K ` 0 KL 0 0 0000 00z K=
- @P 0 LMH"K P U T t d"K PE$K x h p Q
R /h R / R
4
4 4
4 >Y 4 /=
-(0L @ C S R 0 S X0 P
L0 \ / l 0 Kh* /
0- L @ R @0 B 0 S K0h0*
0-@L T
嵖4A0
0-h0L @ S 0;
S :#0 K0h蟖00000 00 /;
-`0L P @J0 @ 0p b0S ` 9 `0 S @ 0 f
P
# o Khk*; / /00 /
0-00 PAL 0 00K0hT / / /
-L M 0 Y ` p P0 P
4 00 :/ @P004
H 09/< F Q P V
58/ (K`FTXCT^]
-L M ! Pp0 P`G U3
@! Q
80 4 :/ PP4 80
0 P
0- PL f@ T"
0 R00 l P
p[/ sZ @ H0 S
44 F <0 S
C< H/ p0 >]I^
-LM0D 4 P \0 kό nG K e^
-LP p 0 ` Q%
V @P"
0 UPP V`
` h P
P P
0 3/ P
$Kk8'S^^^+^M^
0-L@L ប0 S
A d ,0 0 ^ K0hД0s0 0000 0 0 / >
0- @PL T
0 R
P
@ 0
P-L`P@
@ T
0 R
P @
- @QL P
` P
Q
0 R
P
p
0 `o
0- @LPh 0 Rt 0 00 @ 1 S Q 0p1 0l1 0 000 > 0
0- 0L Ph `@ 0 S 0 S 0 S
P
(0 00 00 >
0- PLM K 0 S Q 0 @ @ K T
0 S 0 S K0\ ` P / 0 !`8 0 0 , , ! /hsss@- 0 S
a H W V 3 # R
H W V: 0!< 0`4 0 , ! /hsss
p-P@ ML X` S0 X 0 P dd B0 P TT nP0<@@0 0 0<0 P @Kp0s >^^@*S]P5S\]
-L8Mt00 S 0000 ,0 0H @ (0' 0 $0 0 0 K ^
p-LM@ P(` ` P 0 ɀ@TKp^8HS
p-LMx0 pP R @ H .- T` @L A @@0 㪀L0 @H @ 0 㡀Kp0s^)S
- @P`LL0DP P
: 0P
(( C @ THL Kh, 0sɖ]^
0- P@0L@ T
0 R P
@ 0
-LP @Pp`
V
0 R P
`p W0 P@
0-LMP @P
Kh 0 S ! R
R
0 @ @ K3 T 0 S K0
0-L@ 0P
K0h0
0Q0-L P
K0h,0@ T
P @ 0
-L,M p @ L n PP6
@0 P2
P
\, 0 @
^T, 0P 0@08@8 K 0 0D0H0040@ @0 0 R@ T 01 S
@ S 1 SH tG
R 0@B 3# 00 0` V` T`1H0
T+ 0D0 H , Ǒ 0D R
|H
1 j! P0 1 Z
! Z`
$PD + 妑3 # 00C 0 @8 Kr t Y `80K/K TJ
Q0
Y @0@80K@J
@@i0 S \ C lH V 0 : 6 W,p000p00040040L0 S
@00 @ + 0<00L01 0 < ! 0@ !|@ } W
@@| ` m0 0 SI
0P@0 E
P0 0A T1
P.
0 S!
0PD0 p `
0 V P
m R
g
D
` pD m @ P U @ { @ L@ ] (K >^$^,^:^F^T^c^^l^u^
-L P@ `} 0P
0 Kh/
- PL @ U`
5/ 0 P`
-`0L P@ pb 0 Q R
^
! \ Kh
-L M40 0p00 0`,0 (0 0< 8 P U$
@ 0 S
X
0 S
0C8S V
0 R P P
< K@P, K
-LM 0 0 K
0-`h@hPLM4 00 ( $0 0 ,0 R 0 pt P4 Kf$ KX]
-LM @aP (0p
X m 0 0 0aP0 S 0 S 40
0 S
3/ PP
40 040, P -P -
2 A 0(0 S
3/ Y
`` P
0 R P0V S0!V R F 0 S
C 8 K UA (0 Q @00 S 80K } !(0 08 K| (K >^v^
-P@L pP` U
Kh/ ) P0p `00
0-$@L ဏ P00P0K0h輏0s
0-,0L @ SP D A ) 0 0,0@ P K0h^
0-d0L @ 0P S K0h/ ) 0 0,0@ P( ( ( K0hꀾ
0-4@L 6P00C SP0 0 T K0hn0s
- `p @L T
W P
0,0 W
0 U00 0 3/ U) @
0- P,@L $ K0h
-L p`P @P @ 0 S0010 S
1 0 S
; xA W `A LB ,A tB U
5/00 X
PP P
0 R P!U0 R0U S㾠E W0 0 0 3/40 @ A 4 Z ^0s ^#^-^6^
-LM ` 0pP0 @ P
@0 h T
t00 S
h0 0 S
m; 4/D0 ,< B 04 0 p@L K0s]YL^L
-L M0 K
-L M0 K
-LM 00 " K
-L P` @P
0 Kh lA _^
0- L P @P
0 S00 0 03/ 0
0-TPL$@ T
0 R0(0 0 3/ ( |
-0L `Tp X
7/ P h@,P U
0 W 0 V
P ' P00p `000 0 0s
H-L♍8AP00Q S
0 R эA 0 S
3/@ `,@p T
0 3/ @ ` V0@T0, P
0 R000 ' : |0 ` 0
H
Tp ]0 S
L @*> 0 嘍 V
40 V0 ( $Kk.> 0s]9~^ZL^@^^$0$$ 08S 0 z94-S8s0s
0-@L PH + T
0 T 0A T
(0 @ @ ^ 0 >
-L K h~
0-L@X P
K0h04 /
0-40L @ 00 S 40040 L0 S
3/ P 0
0-40L @
00 S 40040 P0 S
3/ P 0T0 S
/ /T040LP 040 /
0- @PL0P0L 40`0400 S
RD @ R0 ( 0 S KhڌG ]I
0-L @
P
X0 S
K0h/ 0X /
-`L @ {p40P
0 S ژ! Q
0 00 o Q| t h00C0 \ P` Q@ 00(0 1&-0 S@ ፌ q
]s w
0- @PL <0 0C S00Q 7 K0hp ] /\ /
0-40L @ 0 S
00 S 40 040 `0 S
3/ P 0
0-4 L @
0 S 40 040 d0 S
3/ P0 0h0 S
/ /d0 0\` h00l0 /
l00- SL @
3/ 0\0`0d0l00p /
0-4 L @
0 S
40040 t0 S
3/ P0 0
0-40L @
0
00 S
40040 x0 S
3/ P 0x0 0pt |0 /
|00- SL @
3/ 0p0t0x0|00
- PD L` P @
D0 T *H01 S
3/@
-H ` 0DPL S
P
0 A % 0 p S!!0 @D0 S!702:DHp U
%
- ` @HPDpL T
1 S1 G
S
@ R
@ T:
T
lD@H@ Khh% 01
-@LQ L ` @ 0000 00! @ @ T!
T% \
H S R3 Q
S R *H S R3 Q \ S R: I8 $Kk 0 P 0 P >
0- @L 徊0 0 S
S
S P( P$ P P0 S
PP0 0C0 0 R PP0 00 0 R 0 R ͊ 0 >
- PL` @P
P
@
0- 0L @ S O0 0 K0h
-AOL 0|P 0 St PP P `
P < ( P 8 < @ , < s^N^F^
0- @L K0hm
0-<@PL +P U 00 0C0C 00K0hb >
p-L M `4 K P P
0 R
R0 @P 4 K? @4 K Th0
\l= P
V R 0$ Kp^
p-L M P`4 K P @
U
4 K
@P
4 K Kp
-LM p< K P @ T#
T
`
W
`P 4`
040 0 S
0 3/ P U4`< K @< K_ $K
0-LM P , KK P @
P
, K, KF K0
-LM `@ # 0 ` T !
4 K$ P @
0$0 SP 4 Kp P
0 $0 3/ <P0 S4 K
K
0-L M 0p0 `" @P" @0 L PP
0 0ht0 @P
pH0 8 p 5 p,0 K^@0S@*S5SP5S^
-L M p` @P# @0 PP
t P
h : PP0\ \ @P
0 0,<0 ] P K ^P5S5S^@*S@0S(^0 /
P -L
o /0@- ^$
R P 0|@ 5S0\4C02 0 0 R
@b<4 P 0 0 0 T0 B 0
- QL M @0 ` T 1 T 00!Rp#H140 00 Z V : T0 `e V
T0 ` T 0A0 40p Z
!(K
-LMP @ RJ
R#b!r0 "b 0 R |
0 W `` 00G40 0 Z$ 0 s!
U W X 40 0 0 p
0Pe0 P UP5 V *4 9 000 U PEP (KD^
-L b 1 a< 0
9 0 0 k^
-L$MP" ` Rp U PP T
P ~
SD
* 0 0T9 #B i0됔# 0 !8 0 傡 H< 0 R( S% * g4 U1 r | 59 X
0<0 00
0 Pi p R0500000 8040(K^^ b1 a0 - 0 RB
-L$M R `p
P 0 Y RdG S#R"180 0 R |
8 Y PP 0 j됥# 0 !4 I @@ Y$
4 008 @ 000 40pj
040 <00 R S * h<
W1 rD 8 0 0d 0 0@0
004 (K^^
- p P `L VP2b1R1: '! 0 @ p`P J ! 0A
0- @L ! K0h!
0-LM @PP
0 S _ p e K0
0-LM @PP
0 S K0
-L M Rp@00 P ` v V @D
T0 0 U 0 S=
4
@ 0 S2
R R (Ko00"B`#180 0J40 0 00 Y 0 S
0 s
U :@ 40 Pd P 40 P80p
`(K
-L M @P
0 S 00` 0K
-L M p @ P ` T@!@ v X
R d U Ki(
0-L@P P T 0 @ @0 \ I P
0
- 0LMP$@K0$0 `̀ p W
0 P! 0 P ph(0 S
0 0@0 0 0(0 P
(0 0$K@^^Z^
- @P ` pDML 僅 ,0K@# 0,(P$@ @a@ @P p 00 S
400 ,0L0(P$@0@0 @a00 @0 0 (KsD^sPhSI^
- @ P,`L R 0 P @ 厅 s
0- @L\ A P U
H P
< 0 T0 0
T0 o 0s
-ML M0P0 `
S d< `\q\ P1 @ T
U
M P
X
Q@ U@@@ BK+ @XBK+ @F -BK @ Y X 6 PP U
T @ 04 `03/ (KT^sr^x^ 0/0/0 /0/
0- @PL 0P
$ P r 0
0- @
-LM ,0 0K# 8 <D -D K (>
-LM( 0K# 8 @D D K (>
-L 勁 0 @> (>
0-,@L ᄁ 0 K0h辁@>(>
-L,Mh2 ` @ T@ TRTk 50 S
<威%@ 05040 408080<0$p<0@0 @0廳 0 P Q *H \
' L @ Pࠁ Q
$$ \ * S T0H0HLL$ S0 \p@N $ ` p0CS#H0T0 H0P0 0 W7 *
WT P HL KxH D< Kt$KK PD 40K0b S40 P K 4 #K0 0 Y X 4 Z 0
0 pP $`40 0H ( # (@ P (K耾(>@> ʚ;
-``L P @T ˀ50 S
$ 00C#Hp ` D` Kh(>@>
0-@0L P @4 孀50 S
D Q
K0h(>@>
0-80L P @, 嗀5@ T
@ Ҁ 0(>@>
0- @P0LL P僀?o5 2 R , 忀 0 D 巀 0(>@>
-@PL ` pf?o5 2 R p 墀 $ 0 \ 0"H V
$ ! H 剀 (>@>
-`t0L @l P9?o5 2 R L u 0 S 0 n $ T! H e (>@>
-<0L @ `0 P50 S
c KhN(>@>
0-40L @ P( 50 S
- K0h;(>@>0D00 /
0-0L@ S
0 S ʠ 1 P R0CP0 P
0 t0 0 R
K P 0 0 0 000C000C0 0 0 0^^[
0-L(M@ S
0 0 ^ D h0101D0 \ pB <0K40 08 P$ 00 (0< 4KD0BK 0 TK0茵[
0-L(M S !
0 @ 0 T D l0101D0 ^ YC <0K40 0@ P00 0 008 $ D0 4K< BK 0 #K0茵[
- pPL W7
P3
`@ T 0` `0C0 0 W@1 R
040
;0 S0 o P 0pd0 000d000d0 0 茵[ -@ T 0
p U T T # *d /
p-L M@ KP`m P 0 5 @ Kp
p-L M@ KP`W P 0 O @ Kp P CA P CB / / / / / /, / Q
: Q 4 @o /4 9 @o /4 /4 ! @o /<0 / P8 /@ /
-0L o P@-
0 0 0 S @ P0 0 0 Q D0 @0 0 S Q0 0 0DH N~s
-LM40 p4 0 R P@0 0
tB~p4p$ `< P80 Z7 Q
0 w 0P
P R R R_ P[ R XX
PV R QQ PL X00 40 1xF~00 XB
0 S h#h3 T# 0 S ! R
V S
0 0 0 S . R S P
b! < 02 0 Q @ @d~0 0 S l"l2 L" 0 < P8 S ! R
R ` S
0 0 0 S z. g Q S P^
a! U< 01 0Q U@P 4X <0 < 0 U P$
P! ` P 4 0 `F <0 #<0 P
0 0
`P
0妯 080T 0`80 0P 00 00t} 0 @l @ g (Ks HD]@]^]N]^
- P`$@L } M} s 0 Q P
00 0 P 0 0 / /DH 0 Q P
00 0 P 0 0 / /80 40 0 S \
0 / /DH80 40 0 S \
0 / /
0- @L | T 0 0 T
0 01 S
0 0 0 t | 0 0 T
R 0 S H S < A T @ @ | 0sDH
0- @PL X u| P0 L0 0 R 0 T @
@ | 0 0s
0- @PL X U| P0 L0 0 R 0 T @
@ | 0 0s
-L M pP@?
P 1|0 U ` V.
00 P00#
R P U 0 B R |0 0 U ` L| d0 01 S
T
0@0D ;| P (Ks DH
-L M pP@?
P {0 U ` V.
00 6 P00#
R P U 0 B R |0 0 U ` { d0 01 S
T
姩 0@0D { P (Ks
0-4QL @ P({$1%T 0 U
1 01 S
1 0 0
{ 0 0 U
R# \ 0 0 \ 0 0 1 S
$:@: #F 0_&0@ 4 P` ,<0 ,@ $P @ @ P { 0 s DH
0-4QL @ P(:{$1%T 0 U
1 01 S
1 0 0
k{ 0 0 U
R# \ 0 0 \ 0 0 1 S
$:@: #F 0_&0@ 4 P` ,<0 ,@ $P @ @ P 7{ 0 sDH
- @PL\ pz `8 { V
0 $Kk / s
-L @P`p P
0 $Kk /
0- @L P00 0$00 0 0K0h/
-L @ P`p P
0 $Kk /
-L @ P`py P
0 $Kk /
-Lh P
-L` P
0-L @PW P
0 S
K0h/ 0
-L @ԀP`pC P
0 $Kk /
- @PL\ p4z > `8 qz V
0 $Kk / s
-L @P`p$ P
0 $Kk /
-L @P`p P
0 Kh /
-L @P`p P
0 Kh /
-L @ P`p P
0 $Kk /
0-L @P P
0 K0h/0
0-L @P P
0 S
K0h/ 0
-L @P`p P
0 Kh /
-L @P`p P
0 $Kk /
-L @P` P
$0 Kh/
-L @ԀP`ps P
( 0 $Kk /
-Lb P,
-LZ P, / 0 S 0 0: /
-L$M ` (, p!pI၆Aa0P(0⠡
8 40 唡+ 408 | p :/##K$0 S #KP:/ W #K ?4#K:/$00Cσ S0Ġ ? 0 :/ U2
W $ (0 R, cKB08 ` p 0 ` :/8 0,@`p P 0 0
08 (Ko/(KXCT\]HAT ^_^K^%^.^8^P^
-L
P
0 S
- @L`P ` xl x 0 t0p0 P0 0T0`\P
0- @Lf
j
X 0
- `lPL @poxH Q@
@
T
4/ @ x
0- @LX o
P
0 0 f K0h
0- @Ll Ax` K0h=xX y
X
X X m
- XP 0L `p@ 00 $A ?3 Q P @T P0 T 0$@
-L$M@P 0( 4 X ! )!0 0R ( Q:8 Q
P
<0 c00 `p
\<0K
TK $ ?$K@0/? 0K $ 0 W V
* V 0 ,
P 04$0$K 0cK W V : W V *04 #:0# R pp W
00 00( $ 0 ` p 8 0 (K
- P( L@ P :8 \
` 8 < ( $ & , 8 5/ Khʹ
-`L M4PK @p V4` 0
0 00F ?o2 Q P R6 \! R
@ 08@ S
a" 0 S
Q< A`" _ 808 Kb^^
-LfMp2 P Q`
0 Q
2 Q 0 0 RV
0, 0 W V
,2 Q
2 Qy
2 Q
2 Qx n 2 Q^
1 Q
o 1 Q_
1 QJ
h Qf/ e Q
m?Kf/ ( 0 R Y E/ }O $0 S0;30&:`:#6i0a V! ;
0 S
b 0 0 00000 0:10 S& 0 S '
P !
ܨ 2
Ө 3 3
5
3 Kd@d@edAd@edAd@{dЀhd |dyd
-0@ S<0`4 c 0a0/o?o b 0cP T0!0L P$ \S
RP
0 SM
,9#! \
R
0 S
0+$ ! p& R
("( H R
("( @$ R
0 x p V
d N x U `
V 8_ V
$Kki^^^^^^_^
-L M P p @T
P 4 Pğ$ 8a p
40$
0 ? *
ꊡ 400$
? p`*
0 K P
| 1' 0 % @P0
T P0$0 S 0 $, Y& 0 D (Kx^ ]] ^@ ;^
0p-LM@ 0P0 K ` P
0K P
s
0- @L 8P t 0 0 0 @@@K0hTt>
-L , t(@(P(` T * P
>!_!_s0 0 0
- @Lp `Pb p` P$Kk
0- @LD s 04 R0 00 0 00 0K0h t>s
- @P0L1014`QP1 T
0 S
0 S
( ?@
-LlM `1p`K10Q40 SqpZ
00 S6 0p!t KD%
tKp KxK| KC @PJ @A PH
@0<@ 80 d@ ` K4 4 d KA @P
x | B2 |0( P P x |5B ` Vp0[ S
` Zs@ Ws0 xp
3k o K x k?0 H (% s s K&^d^|]/n^
0- @ L0
$ R$ 0 $0 , 0 0 0K0h8 K0h s
- `PL s @ Hs +
s@$p W
0 S 7s T
1s Y ,s 0 0 0
8 P
s ;8 P00s
- SL P@ 0 S
\+
B 0 0 S0@@P " Q B P
` ^ \
0 S Y KhT \ B R @ @0
0 -LM 0 0 0 0 K ^s
-L PS P p
(P,@000D$ Q
$A \$0$0 0@ $ @P
4r@ 7 0 U00 P 0 0 0 p 0 ^
0- @L Q
P U00 x7 r 0 $ K0hT 0
-LM0 P Qp0 ; : 0A X6 P 2
` q 0 40 0 R
X *0 &r 0 W 40 S
x7 @P
r 37 r#@
0 (K
-LLM@P `D 0P@0
0 0cH0 00C@0@cH0@00<0 00L0 0#0h0 p q<@ 0 T80 *@ \ q 0 R
< P0 S
< P @@aH@@L @T P X P 4 0
`\ j` Ed RR
D PO 3 # P 3 " \8
Z!
\` PH ^
I Y X @@ P@3 T
@
8 T d8 Y3 \l X d e P X Q Q P4 4 0 0 0 @ @`H @ @ SL 0 8 EP 3 #D X 3 " \<
Z$
T
\ j h H ^
\ # 3D@ T3 \
@
8 T 8 \ ! 3 R L e P d + Q Q P4 4 0 0 h0 Q 00 S 0
Y6 @P
p 6 p#@ @s 4@00@ p 0 @(K
-LM K
-LM0 0 0 K
-LM @0 K
0-LM @P \ " P \p 0H 0 0 9! @ T
2! @ K0hp^^ ^
- P`L @;p zp XpI
P I +p Q.
0 T) W( : T W 0 S & X T W * W@D @
* 0@D 0 0 @ S 0 0 :p D 8 ! Z
5 )p ^9^
-L P |S|SlS|S x! W^P#
P-LPp`
88 S L L L P L@@ W P*
U% XSLSdS@S 0 0 0 0 S
!0 S
!0 S
!0 S 0 @D @
0- P@L K0h
-L,M#K X Pp `0 0 = Q 0 !0 W:0 Q0G` @ P
0 R * CPK U T ?#KK Q P
i *d R`00 0 #K < 0 S
K#K+K(K|^t^^@^^
p-Lˠ M@ @ p P
`@ K P Kp%^$^
0- @ p`DML!1,PK@%
( 0 0p,`$@ @@ @ v 0!D1 0810,p0(`$@ @ @ b 1 0 0!0H00 0'> 0,p0(`$ @ L0 0 0!0 000'>,p 0(`0$ @ 7`0 0 0!\0,p(`0P0$ @0'> 0 0 "(K=^S^PS_ S0S^
0-LGM @!< K 0MK L1 P-@G
8a KH0|0 P0x0 h0t0 p0p0 0l0 0h0 #(K"&K"%K" 0)K#%K$$K$ 0(K0 D0 0@0 0 K<0 080 040 000 00 / P 0pe0 0@ 喘
(Ktt
-L$M` @ p $0 P@0K0H0 U!
Z 0 S' W @@ @ K3 V 0 @ KH @0K 0@ K00Kp R ` 0
@ K/ 0P p@f`P H0 JH0 @ (Kt R P / / R P / /
-L
- `@hpL<PF Q
Y 0 P 4 P PU T@>
p-L M0 @P `c 0 T * 1 @`@ X fi, @ 40 ,0 @0$0 0 0hKp->t>SqE^^
-L P` ` @KiT0!@ Q 0@PD`, i @ T |i t>^
0-@ P bLU" 0 Kh!
-\ L0 S
P @4` 0d0?o 0c s
C1@ D 2/>
-P@L ` P'
`Q`p U㘀 ʀ 0! `! 0 ! 0!!`Q0 !hsss
0- P@`L0 0 Kh>
-`H0L @ b P e y U
0 Kh/
0-(0 @ 0L0C0g 0 K0h/-
- `@L0 S
P PU T@
p- @ `PPP0LM (0 $@ @ mh4 @@n( K( K߬ hKptrR>
0-DP @L 0 T 0@
0 @\ ` P / 0 !`8 0 0 , , ! /hsss 0!< 0`4 0 , ! /hsss
- 0 $K1o1 1 \
X
K 0#K#K 0#KgKfKfKeKeKdKdK0
C K P @ { 1 0(K$
0-P @L T
0! 5/ @0^\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
- @L` P ]00p0!0 0 P0
S<<<
S8@08A?@ Q
0 S t Yl0 :l0#
0- @ LD ,0 R * ? P
p
0
-`L@Q1 S 1 S0
1
p XY1 01Y8 U0 0$0 0 0@ `00耀u
0- PL,Mtp `H0 5Yp
DK 4` y @P @ T
04 R T0@ @0@@ DK 40 d @ T h
p0
`` `"1 0 0 S 0` `10C1000D00D0H00CH00 Sl0@
0l0x ! R% 00 0080 S 4 S H K 0 S 0 0 S0@0@00 0 S000 <00C R 0 S 0 0 S0@0@0@ XHK K 7 @ T
0 S
@ꛘ]/^
- P`L @ T
0 S T003/p0@ 8
p-L M @$pXP0 S
0 R 0 0+ T +XT XXX \0 RT \00\0X T X JXT 00C S0 T =Xl t`X S @~}
-LM@p` 0 P {X P P )#KW΄ ! #K S R X
R 8! 8! !. C C uW0 k 4 Q <<@(Ku
- @`tpL W^s^^^^^]^^^I^v^^^^^
- P`(0L @ T
@$
- @tL pUP U
r `P P P U
g `P
PP U
\ `P P` U
-LM P @ \ U` Pp@ KUH1 X Wp 0 0 1 !.1
q . B81@1<1 D1H1>00 1 100 1
01 0 p R "U`tP U
hh ^ P Px0P0 @0x0 0 S H OU @ K0P00 @00trR~}0}$
-L$M P`d p @P
0 00000 0 000000o K
0-L Pd T`0t@ T
D1H 0D1
U Y, TD1( 0CD1t@ K0hT0}$4}
-0L @ 0 S ژ0 0 S 0 x o P T 0 pa 101<181@1 T u r $Kkm- - T
-LM`0 @ S
d 3/ P
tp U P ' 0$`K0&0吀 P Q
8 00 R 0| 0c S :< D00b, S : m T(0 S
(K $K$
- @L ` 8TP0 ; S@ R@
0 T 08 Q
;P0L 0P0bT PP, TP0, 0CP0 UT V @ 0}u$4}
-L
- @L SD1 S
Z 0 R 0tPx00 poo +T 2 S 0 0#TᏏP U
Q
0 0 Q
0 0= U
, V S $KkG0}$u
0- @L K0hp`d /
-LM p`@ Pᔀ0p00 R
B T1 0( 0 0 Q0 `0( K P( K
-L `Pp @ᄀ0p00 R * Pp 0 $Kk \05 5: P
-1` 0L @ S 0P V 00 S
0 ` VP 000p
:> P W
0 V
T
T0 0 T 00 S
W
80 T 0?o2 0 S
0 0 Kh/|
-L R 0 老00 S / R00 S / -S
-L< < 00 K h|]
- `DPL Rl@@
1 @ T
M\1@ S /
0- @PL
0 R K0h>\0/
0-L 0 @ 0|
-0A?o R2 0L STMp0 0p0 0@T `0 0h0 X0 D0K0P H t0 T0 % P P
X00X0 P0 S Z
`0H Z 0#03 R0 S H PpT00T0 @ P
`L
0\ T c Y
$ 0 Yl
* YH
YB
# Y `T0- YG
. YG
+ Y D Y{
9 Y 0\0 S U Y
X Y'
O Y ` o Y
i Yi
d Yf
h Y} @`l YH
n Y
j Yu `t YJ
q YE
s Y
j x Y
z YA
u Yd 9 X 0 Q\ @@ a\ `T0 * Y 0 0T @?L0 T 0I Q#Tє?L0 k\00I⒓#\0 T0T0 00I ST0 0l ST0`0T0 `ll ,0K c pL @" `
p
@@p@ p
@ @@ HDH_ T 0 @t P0- p
X 0 , @ 0%[ % 0X !
@@p@ 0 <p @
,p 0 p @0
@ P P @o 7p Ph0 @`0 xe 0&p S0L R d0 4 Pd0 @
L @c R d0 @ L d0 `
@@p0@> ,p P @7 p @@p@ p @
P@0' @ P0" 5 h0
p
@@p@ p @ @ @ P0
0`0 0 L L R kƣ R QD0K0B
S
S1
D0K0 t0d0 P@0 c0 R R0 0C & d0 U T0C d0
0d00
0 @Pd 0@@B D0K0h % c$".@P t L@ cL Y
p ,0Kc @L L T Xd
d d \X d S Q P UX a l l R P R
Z
` H Z # 3 Q R H P x0 x0l B X
P R Z 7 ` H Z # 3 Q R , , l0 H P %
P R Z
H `/o" Z!3 Q
0 H P0 l0 H Pl0 `
Q R
U 0\ dPa U P R Z
` H Z # 3 Q R H P0 l0 l0PE0PL @b T P R Z
` H Z # 3 Q R P H P0 l0 l0@DL @ S
P R
Z
` H Z # 3 Q R H PL0 L00 d
P\0d @b T^P0 S Z
`0H Z 0#03 R0 S P H P b@Dp0 SH0 003/X (K謘]]^
--LM 0@ @ @ 00 0 S @ @ K`u
- -LML0101l
1 0 S
0 00 0 K
- -LML0101l
1 0 S
0 00 0 K
- -LM00 0 0 K
- -LM>00 0 0 = K
- -LM-00 0 0 }, K
- -LM 00 0 0 l0 0 S R K |
0-LMP @ 0 P V 0 0 S K0h:K0|
- -L M00 ) K $W^
p- @PLM ` K`" 00, T U
0 U0F 0ćKp
-L L\1 0 S
PA1 S
8 P T
x!(21(240040 A0 S 0 ` V`Ao |`0p0 0 S
0 0 Q 0 k 0删 S
P 0 x ] P o` V 0 S
<0< 0 Q01 K|^hu4ua0 ^YL^]
- -LM
- - LM0 0 k K
- @L M < 0@ , K,@K P
> KA]
0- @L* K0h-
-- @LM 0@ @ @ l00 0 S @ @ bLK`u 0Q
^ ^
p- `LM@P 0 P A00 0 S 7!Kp`u
-0-LM @P @ P 0 S
c9 P
P@ v0 0 0 0K0
0- -LM00 0 0 K $W^
p-L Md0 @ 0P`
T
0 @ 0 0 ` KphKp9$W^
- -LM K
- -L M00 K
- -L M K
-LM Px0` 0p@@U U
0 P D 0 p N$0 0 S Kh K9$W^|
- -LM K
- -L M00 d K
- -L M K
p-L Mh0 @ 0P8S` T
0 @ 0 H 0 ` RKphKp9$W^
- -LM K
- -L M00 K
- -L M K
-L M0 0`pP
PPl0 X @
0 D 0 p 0 S Ki K9|$W^
- -LM K
- -L M00 K
- -L M K
-LM0 P 0`p@
@@j U
0 P D 0 p c$0 0 S Kh K9$W^|
- -LM K
- -L M00 y K
- -L M K
- @LPT 0q T` L V <@L0 1 0 1 01017 GL
-0QL p<@1 S' !0c! 880 S *aP `+L p
$1 0$1(20(2 0d! A p
$KkK
-LM pRP-
0a@ Kp0
<0 Q !Pa!( Q
*Q PK &K z P
K K 2[ p& KrK P$K
0-d@ P0ML@PD00P00 P 0 PzK 0 00
K0C/^^
0- L @ 0 00
0- @L K0h
- 1L @ P U= 0 0 S 0 0`100 :K PD00D0 @ 0D@0 0 rK U 0 x Ǎ 0p
T K PP
( 0@ A WK 00| -DC -D@^rR\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
-`QL 0 SS
` JD1@p T
j P
U 0 R00 `000 @@@@` V
M P
8 0 R0D0 @000 ```P@0 S
Q 00C 0 $KkJCD / / -X` P𝤀 0 !`!800 , , !hsss 0!< 0`4 0 , ! /hsss
-L @ P ` P
0 S@ @
0- @ L P000
-LP ` R @ I aP
0- @L V I } K0h2 0 0 /
- @L Ppn ` o 0 0(0 @p!0 o Kh{
-L P @`T p U 0 S 0 0
U0 R `0 S
Khb
- @L Pp2 ` 3 0 0 @00 0!0 2 Kh>
0p- P@`LM0 0 (@ $P Q 0K
( K PK ( KW 0[ S
rI I 0Kp -HWT, / 0 1 \ S / /
0- L @GI 0 00
-LF^
- @ RL``E W X0 S zE \00 S\0 0\p 0X00X0 iE( P
80 0 0( ļ0 CA x 88 S0 0 0C 0C 0C P C / 0 R0 0 /0 S 0 /
0-LM @ 0P 0 (4"< $4"< 4 0! R! Q 000 101K0
- LhDd1,@ TM
` DE PF
P pDUX UP U W9 q P
0 1
S (E P
'
p쀔 WP P D P X
Q
1 0b100C00 S 0 D0 W
A @DD ,Ko+
- p`L P RDG`X0 S T D P
V h AD\ D0 L ؆ 7D\@ 0 S 0 X00CX0lD ^
- 0 L3
@ h0 !l 0 Sh0 h
-L Pp` @P+
`P " 0p00 0 pC 0 0h00h0 @h@ 0 S 0`h` `@! ! D
0- @L4 C 1( S$!$!$1 !
D K0h /
-L 0K # ` 00P 0 S
; ? > 3 Kp踂T
-L P p 0 ` F`@`@ P
l0P 0
P D0 0 PP @ P
t
0-PL @> 0 00 PP K0h>
-L{>|Pt@0 S
" Q P X &HP 04 `0> 6/ `>" 0" EEX
0-P@LP0XT 3/@ M>& 0 S R& D K0h> E@E
-LM @ `Pp3>Ѐ""KK" Q P
W`P@ 0(4
"K 0"0x 0
0,"K 0"0x 0vB D> $K E
0@ - L S T(TT T ^
-LM 0k?0h0 ``0 0K00 `00C. `P
᭟ { :L0 S
: p / `LP,`P v:0 U
:0 (0?0t0e 0 : : Kk^s^pT
-LDMX2X`0 0 Spq 82@ 1lK 0A P L0? S{ P0 Sx d0 Ss
`0 Sp Y X P
P
P i LP Ua
%:$0 S
H WL0 _:S \: V
$0P80 0@ l KL P 0$ S
$0 S
0 $ 0 0@ T K 0 E K0 R R /
-LLM0!p L@ Tc
S/
?c| u'
?R 0 Xa / 0> ` ?##`p / 00 ` V YP U Y` 3 1 ` 8 pp0PC
W R
0 S
H0 R
$0 S
H R
L0 98@ lK P <0 S
7p q PP
$8 # (K@B
-LMP p U% ڜ00 U! P ` @P 0 S40K j @ 4K P
# $K8
p-L M P` > P
0 K| @ 0 0Kp
-LP@`' pP&
700 0007 t0101@0 0 S T *T0 0 T * U P
p P P <0 @
-LM K
-LM 0 K
-LM ` P M
( R
F !p R @@P@ Z!0A
Z
Z0 & PP @P! R
R
R% @
`
7` ` K7 P0 @0 @ ! B(R@ 0
@ j $K
-LM` @0Fp S( ꨤTTT`TT X @ s P
X 1 0 @ K P K t V P K R PP
V> 0 @
0r'z W0 K
W
f @P
>
0 0 @
4/ @P >
` @ Y
V TTȚT(T4TPTxTTTTTTLTTT 00@ S \ *@2 0 \ : @ 0 K *0 @m 1 1 0 @n #00 00 S
/ W @ @^ 00C 1,`K 00& 0 0 3/ @PM 0 "
0, K0" 0, 03/ pP 0@
0, K@00" 0 03/ pP
0
0 00 0 03/ 0 0 3/@ 0 00 0 0 Kt0 3/ @0 0
0, KP0" 0 03/ @ @ @ @ (K脽 ~f}f3{f@|f
0-L@S P
p 0 0
0-L P@D 0P
003/ @ 0 0
-LM@K P KsK
- PL@ ` P
(00C S TTT,T-@
0 S< @ 0 \ @ @
-L M @P 6
(0 S
- / 0 `1K 0#K"K0 S
S
S
p rKg 0 040K 0 2K2 000 040K - @ K
-L M@0 `
T 0f 1 R 0 R0_ @ P @Q
P V
( P
@ P @-@I 0F S 0t00 S
e B V LTLTLTpTT T@2 @ 0 40 ,`5& @T P@ 0 j p 0` P` p`p V 0@ V0 P
40@0 0
@ @
# (K
-LM0@0 ! y K c
0-LM@P b P 0 0 0 K0 e P K0
-L0MpD D K< P8 0 U `1 01@P ,P D0( @$0 ! 0 @< K04/ @P,
U
t T0 0# T0 S @D0Pb 0 S
@0 p 0 P K$N
p-LM @P ` P
0 0`
Kp
-L|M R`
PP
0 Z
(0 S t0 S|
00 @Pu 0剁| Y Y@l 0 0 p l0K 0 @P0`
T p 0|!` 刐 !x0 |0 0!D t Y | | Q? R= 0`$1 0 R `
Ip P
` 0
@ K0 |4/ @P|0
Y
t T # T R @ 0c V 0
R
@ p @ W
@ (K$N
-0ML 0 0 Q K
-L0MPH0 L0KD0 0a@0 00 1 U 01pD0L 4P ,0 @2 0 @D K04/ @P
40 U
t T0 0# T0 S @
T 0 lp 431
0g q340PcD0 0 S
@0 o 0 P $K/$N
p-LM @P ` P
0 0`
Kp
-L|M R`
PP
0 e Z
(0 S t0 S
00 @P 0剁| Y Y@~ 0 p l0K 0 @P0`
f p0!x0 ` 1刐 01D0t0 0|0 Y | | QO RM 0`d1 0 S `
*o P
`` 0
@ K0 |4/ @P
|0 Y
t T0 0# T0 S @ T 0 P r20
10)g 2|0 V 0c 0
l R
@ n @ W
@ (K$N/
-0ML 0 0 > K
-LM01 P `0 P
0
@fv @P tP@ / @P#0 U
P v 0D@ 0 S
o( /$0 0 0<]@FHFF
-LDM @P
T @ 2@ 0@ @@@0 R2 @ / 0 @"R,`K@& @!2p 0
< 00,(p$@ @@ @ ~ 0!L20,0<(p 0$@ @@ @p0 ~0 Pk
0!1q 0'> p 00,($@@ @ }0 0 0!1 0'> 0,0($@@ @ }0 0 0!X1 0'> 0,0($@@ @ } 0 0 0! 1 0'> 0,0($@@ @ } 0!0p 0'> 0,0($@ p@ @ } Au `P
@ \\ t@ @ (K^t@FF
H^ ^^@ ^(^7^E^<]̿T+^ Q + 0 dF
- @ PLBo P
0 R00 P U P
0
T
.z Kh
-`0PL1p 0a.0 0C S @ @0$N@. T
P ⛋
-L M@ p 0 ` PP6 . j @PpP(
P P0 P
p.
P 1 S!!1! p W 02 0 0 w T s .( .0 o KF
-L @P` P
(0 S U
0 @ /. @
-LM p P P 4 K @P
! 0K P 00 S,00C> S 04` S@
0 S@ 0Kx ͥ0104 =. r K
0-LM@( K P (P $ K⳥ &. [ $ KK0
0-LM@ $K P ( K $P P 0 S
( $ K␥( 0 00 0- 2 Q
$ K K0
-L$M01@ 80 p 0 ` PP 4K0 K! PP 00( 8# <<0 T
0!$3P PP# * Q
8 W@
R R R 0 R 0 0z @ \- 0j/
0 S0 T 0 W `0
ä,2 0$0?(0$2 0 0@0!2 0
L1@ @0 .- @0 pP
@ i-
d-P\ 00 0 0 0 0 PF
P-
PH < R @ I-PA <0 80Pp i! P <0P@ :- 1 vo ᰁ rτn 0p Sk/1 @! @ $-`04 8 p4 0 T
V
(KP @ 0 00-4 08 ,ꔙ]@S^\^o
@FF
p-L M P @ `
P
,Ku P , KA Kp
-LM4 K p@I PPy 4 nJ4`(0
SR ,0 S% T
00K P
0@ 04 0 2 0 0 P"
# P < # P* 4@ T1 c0 ?o 0c 0A 0 P 00
R 4
01 S1 B"!,0 0C,04 T S
(P @4 r, U 0
?o W2 0 S P
P - (K
-LM0K0 0 0@ i P0 0K
0-L M @ PP
$K P $ K(0K Q P(0 0K0
-LLM83p RP 0 W S : Y 2 @ 0Ph0
h p ` K
q `P ` rr W(`w
`P(0 W(`hpq , $0 R! 0 S
\0K P
0\0 ` \ P 0
# P< # ` pK X ` 0h h! @` 1@1ᨁ ` 0 S
PJ 0 0000 @@, R p `0p W
p x Rp 0 \ Kh0 Ţh0| P L < 匀,0` 0 ,0` A0 V ` x+
V
G W
X@ '+ \K_ d+ ( 0 @@(K@F/
- 0ML 0 K
-L M @ P
$K P $ K K
0- PL@ *0 T
++0 '+ cP
-L(M `Pp0A P A
1 P 000h0 0(0K01\00 00 0@0q PP
ۏ ' (0L1 0 *( ( $0t Q
t0 S
d0 S 0 0(0U( 0(000C0 * $Kԙ]
-L Mp0A `1 PX N @P 0 @
( @P 00 , 0k?0 K 0 40K ( @P 4 KE K
-Lo L1 0 / 2 0 / !
-0QL p =* `P y* > W 0 S
$0
B j* @P $ @P
@ P
$ $00(0 S
@ H*
0-P0AL ) PP 8* 0 ; 1* 0
0-@0QL ) @P !* 0$0$$ ( R
@ @ A @ * 0
p-L M @P0a ) 0 K @ ) T Q
K @ Kp
-L0M@ p? T` $ 0 L K0Q0<0 x0@@ 40 F 0``0 0 ) ) B P@
T
LK [ @ ) ) K/
- P0aL @ l)L1 TP
U
L1 T
4Q U
(0 S
DAE 000D15D1(0 S t $ @ @ )
-0 L1 P0A 0!!`p /) Q
01 T L1 S
a c) _) ) PP V) <0 R $0 2$0 D)PT
-LMP 0R
0 0(0Kg P
+ (0 0A01P%%4 0`p ( $
$$ )% @0@ da( a p
# P< KPTe^
0-LM @ P
$K P$PK
P P 0 a P
K0 [
-LM S i
0D S #e *A T0qPK P Q `P
0K U,
( `040##4000 0 j(00 0
S 00 S
0! W L! Q
0 (0K U
$ " a ( B( 0P
0 F0L Q $ "$ F n( )((KPT
- p@ WLqL ` 0 P 7 @P
? T 010a ( pP
E( G B
PA PQ
5( T
5
p-LM0 `P1 VLa0A ' `P ( P Q,K
, K1Z ( 0, KKp
-L M 0@0 K P KK / /
-L@ X`
0qDP
'$ F 0 S @
' T P @P 0 S k D 000 / Q 0C S r / /
0- PL@ c'0 T
'0
0- @ p`@ML! $PK@% (00p,`$@ @@ @ u(0 S(
0 0 0!0'.0000,p (`0 $@ @ u 0!T0,p(`0H0$@ @00 @0 0 u$Kl^PTq^T^
-LMPps G 0 ` & 0㨀 S * @! R
04 K+4K AY0T &' ᦚ U@
T 1 P @ls K{^@-P^
- pLM`K P KhO K
-L M 0 P0 000 0& @Px a%$0 o R8` 8@ 80 S %@e 0 S U P
t%@V 0 u00 G
u!P U
$ S Q
%@A a _% p W
R
P
80 P
% % %$ %$qP P U
08 R ("|00 S P _$Q o%4 m% Q
0 K
@ @ (K@-/ /@
-LM 0 P0 0 p0
P@x %0 S U @P
j @h u11P
!1E ! 00 0x,%H S0!
S
C v@x@ ` vx@La
0 s@x@,q $ . P %. $
%`pp@
%@# V
L1 V
4A T I0 P00 fP p $ W
Q
0 K @ @ @ Y
0 $00QE0! 00 0 $ (K@-P/
- `D0LAd1 P }$XA T
pN`@ Kh$
00-L8M000,00H (0 @ < 0 P' $0 A0 0 rK0F^
-LLM`0Td SL T A 0 S
<K p 0d@0 d0 S 0L0h1lah10\0 \ L00`0 0X0 P0XQ\QT1 0h0 d0 SL0`pa \ ` 力`pL0HP P0 1l0 T P0 RD `P0 D P0 D0 PcP_o 0e s V! 2 T QPSD0 0D0 p 0PQ
"p `! 0|"l03/ PH0p `0 H0 PH2 0 S 0` `
$21d1 P # 0 ` `$p Y 0H 8 pF P `T0 S M 0P
!F!`V 003/ Y 㲐FP 0 P p T1 S 0\! 00 00 S
I w >
# W : 0 0 S 0 S
<K 0PX0 P`@ o# 0h R T1 S @ # p S @ #:TQl`p Y#0 W
#@ s808
K\X b\ pP
(K]Fh^
-LM Q t 1p1 21 0 Q`` @>@BBA WPK e P Z
0PN
ጚ Y
0PA ယ0 X 0
0P4 0 q0 0 000 00/o Z" R 0
0
0/o Y" R
0/o X" R
0 K U
0 0 (K
p-L4M @ P`
<K P S pPH0 ,0K # U0A@0 / VH : 0 S0 S `0 H3 l0 03 Q 0 0 S 3 l0
00 S
L10 R5 y y php x?o2 0 S
k0( xP h0 WtP
SP
tP WPE0P p
0P
00 P00
t0hp U
00 3/ C4A0 00 N 00 Z (K/
-L M@ K P 0KqK
-L Mp@ PP
00 00! z `P
01 t`h01 0H S`F W T ` K
-L M@ 0K K P K P Q
KK
-LM 0 P, K (0 Pt A, Q pP
$0 S\ 40 p
W (K, ,p 0 S
A x% `P @F z `0
; 0a o 00 0 @PP
+ X
L1 X
4Q U (0 S P
(K⼳, P
,00 q p@ } T@ @ @4 v, P
(K⟳( P
K@-/
-LM p P K \ @P( `P@
@ @00!
P
01@ I 7 Q
꙳ ,01 : @ ` K
- `L P@ v 0 S@#
@ S0C@|``0 V |0 s0C 0 @ ? V t0` S @
0h@0 T0
|0 V|`ŀ` @
-L^
0- @ p`
H!DML!<1,PK 000p,`($@ @@ @ @%%i 0!00p,`0<( 0$@0 @@ @ i00 S!
0!0 00,p(`$@ @@ @ d h? 0!\0,p(`0$@ @@ @ 0 h $$ (K
^`^^^0
Uu^
-L M 0 0 04A4/K
-LM(0 10 00 00A4/K Q- /
0- @ PL # 0 U
K0hC 0 >
0- P @ L P
; P0 ^:
0-P@L {9 0 00 ,03/ P 7 0
0-2LP Q@b
1 Q^
0C Q@
0 Q0[
\ 1 Q6
1 Q1#30Q
R 1 Q
1 QD
1 Q<
G 1 Q8
x1 Q5
p1 Q> 0 S1::1& 0! S0 0 0!!0 0 t R :0 S * 0 0 `0a R 0 T K0h T K0h 0 !40i S 0\0 0 ( 0@01K0h / 0 s@{f@f@s@}fwt@|fsvt~f|
-dL PP@ ` X0 b?" 1 R @ 0 @ P1B @ @ V h
0- @PPL< 8$1 T0$1
T0 K0hlh
0- @PPL< ! 1 T0 1
T0 K0hUh Q0
!88 S0 00C0C0C Q0C0C3+C? R 0 /
- pLM`KP` @峐0K\0 0` @0 0 0 000 0
0Hc?o2 P0 S (K Q
P / /
- -LM0 0 0 0 K a\^\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
-L1L P @ $ 0 000T1y xB Py t P U A
T1 > coPPPe x ~ P` ? 0000 PPPV S U !
N
U
< 0 000T1
P x
P
;
U
c?0 S-
0 000T1
c 0 ? R U U U U U U U 0 x P S0C L!B 0 0 000 h
^]
0-0L@
T15T1T! "20#
P0 @ P
U 0@ S U ^ H U? @ K0hA0
0- P@L T
6 3 0@D0
0-L@ P
0 S
S I_D0 @0\H0P 4 0( 0 @ 0 0 0(]]h
- LVI 8]
-|1L S
3/
0- @,PL i0 <0 K0hh
0- 1L @ R ʘ $ Io 0
p-L M @^ P
a
@` K P P
T K ` K P P
E K 0 :0c?N Kp
-L M!T1 P R@d TcoO
\ Y B/E B R
T!P ? R9 n R1 3? @ =
0 \ 5p*T1 >0(K0 P P
( ( K i T15T10:0PpPe UPPU J ET [
0
:0\ 6 00C0 K ]^ 0 s
S0 /
-pQL @
fu ` buL! P Q 0 !? ~0B0Q?0 P ?0~0B?0 S 0? ~0B0Q?01
- PLM KR KN KJ ^` V
K^ K\ KZ `. xKp @@ \K x @K K K @p K x@ $ kx K- \ K+ @ K) Kh
-@ `pLX 0n@P @00 ]P$ L 0 0 S
h
-LM 0 0@ Tp3
@ T2
@ TP0
|P U"
0 S * Q`
0 S`
/o P`` 0 S
@ Y
H03 R R R Pd2 `ke t qa
0 " KS K G T
`x k?0 X" KB K G 8P U4
0 Y
(0 S
S 0d K L0!! 0!dL0 KK 0 S G41 Q
G0 `4Q 0 KK ` P 3 L1
?0! 6C 0U 0 P# T1`PE
8p6 0 W0 x 0 Q 0`0`Pa00 ? 0 P00 ڼ QppG T1 0 W D0<
p >#0 PP P w0 W4 /? ' Y6
(Kh/]
0-H@ PL 0 0,0 PP000K0hh
0- @DPL 00 0C0 0 R 00 K0hh
0- L @P Gt t0 ( 4 @ u ` l x k | t
0 . L w;0 ,0 0 @P p!X2,K@(0 00p(P$@ @@ @P y`;0,0 0 0 0!1 004p0P(P$@@ @ c`000;0,00 0 0!1 004p(P$@@ @ M`000;0,0(0 0 0!L1 004p(P$@@ @ 7`;0 ,0 0!10` `0 04p0(P$@@ @ "` 0`!0 0<0K0p,`(P$@ @@ @P 0 K0@
`|0 0 0!l0'.0d0,p(`00$@ @80K< K0 K_(Kh.U U^^^^^^_U^0- B , !1 S! 1 0 ! u 0 "Mh
0- P@LX 10 T00 P00BI d 0 ` 0h
0- @L$ 00
( K0h
0-L @P
T Q
@ Q
c? > 0 >;0
0<0 Q
x $ IK0h0
0- @Lp l0 R g/0@ 00 0P000 U
0 F 0h/
- PL `p0 S0 @
PABI
|A T
4/0 # P @ P
h
0-D0L P # P P @ v k 0蜽h
0-L @
$ e Z 0h
-TaL P@
J
" 0"\00\0 # 0#$00$0" 0"Hq&
%,4
P
#
S
P
@ U
<0 S P D P P14
0 T S 0000? Y$ 0 ! T1
T0 S H1
e P
x P 0 00]P1
1 S
3/ P0000 P 9\0 3
f1 e/o S" R
^ 6 3 09 g1 e/o S" R
T15
0T s
?T15T1f 2
`1 S S R a1 e/o S" R
V k `1 S S R b1 e/o S" R
V R u &
e1 S S R
0 <0 x$ d!0B?o2 RPP U
d1 S S R
T15T10<0
U
P
P
U @
P
P < S [1 S S R
0 S
]1 e/o S" R$
c
0 R
P 0 S
Q
000>;0 N
\1 S S RP1
P P p
p 0
P P " l@ p 0
P P
V
@ X
^1S S Q
Ll j1 S S R
7a T 00 S
1 RU Q sM V PG X U ?
Uc
X1 U
Y1 U
Z1 U
U
0 0@f : 0 S > 0
:0/ _X1Pe_o SR P U
0Pi UP# U
PE0
d!e1 R $Kk h ]
0- PPL@
@ L 0h
-L$MT10K2T10 @90 0 0 000 K
P 090K
0-T1L @
T1T 0 h1 P i1 S 0
-`L P p
A@ @ P
1 R@
0 P1B @
T Q
X
I
h
-TL @P` 8
U
" R 0 h
-LDM0 @ Sd `3 0 `#K44 1` P 0qn
T1T0
a1 Q, l )
S&
X4? P l0 1 0 S ,
` T
G
TB
?
| `|
V
T0<X0 C i1h! S\ 0 R? d P R 0
S7 R[ P R
` R < Ka SP P0 S < Ka0P0 L Ka#KK P
d40D ` ck k` P` 0 U`0 .
k T0 S@0\0 % 0` P!B @ P00# X0
d0
L
#` 0 ( `$
h1 S# VI
V# VT
{ 0T -h \ l0 PPl0I c eo Q P
h
R T0 QT0 S6
`P1 p -X0X Q S0 0 Q 00 S# 8
ᜌ ` V 0 S
X0 S
U
X1 U
Y1 U
Z1 U T0
U 000 !
=k 0 S H1
d P
x> P 0 00P1
1 S
3/ P000 (Kh/
-LMp- @ Q`P0 B Q. *X- Q+
L- Q'
B <- R 0- Q
B - QJ - Q
l B QI : Q , Q
, V= , R8 뼬! 0! \
9 + l
R
! R
l > PD $ D< @(< , P
! ! + V
X + V
+ + V
; V
0C V8
0 V 0; ; V
0 V p+ V
B V
; V
H;0 S 8+ V
,+ V}
B V
V
y ; VC0
W * V
: V
0 V0
h : V
: V ]
_ * V.
. * Vp
$* V
: V:
1 |* V
t: VH
S 0 S000: L: Vl
L0C VF
0 V6 , = : V_
0 VG
, * V
9 V 0C VQ *0C V0 L 9 VI
D9 V
9 V
,9 V
90 S 0;0 & 0 0 0b 0 P UPP
7 h P 0'
T S
0H0H S
^ pP
0D 0 0 p Ksc PP
n^ " 噛 P 囌 d^ U @ T , R 00C 0 8 ၂08 W
R
R3 l0 0
0 S0 0c 8W
! Q# l0
0 S0 0 V
! R l0 $0 0? {
P19P1 070 S
P 6 V `h
]L
0 1 S
3/ PPw 0P1$0l1(0p1(0 S E
L6 V#
T1"
2T1 `@P ? K `K T12T1 0VH10L1T1 0;; 0T1" 00T1 فL
v 0 0 P !
0 X
nK0 0 3/0 3/ PP
0 0 3/ S K 0T!
% 0 0 00 n 0hX /X! /
0-H1L @ -
e1Pa_o SR P U
0\
P! <0s P
0 3/ d1c o S Q
0<0|1 S
$ O |13/ #P 0h /
0- P,0L @ T
{~ P@ 0 /
0- @LP * D0 @ P P 80 P 00 S 00 0 [ 0h
0-L PT P0 @ T
0 S 808 T T 00 0 @ > 0h
0- @PL
0 ,0$ 8 T T 00C 0K0h'0h
-L @ { P3 ` P Pp
P煁 Q
~ P|0000
00d0 0 S
R 080, @ R 0 ? hp]
0 -L P P
8 ^^
0- @LX T08 T T
0 S
0 00 S 0h /-D ʠ ʠ , ! |! R
0/ -D ʠ ʠ , ! |! R
4 0/ : :# 0 0 1 /
- P : :P`#L0L 0 1 @0 003/ "0 00|Q_ h
:0-: #h0@ 0L R 1
R ,P@ < PH P00 0$ 0 @= 0 0]]h
-PtL ` P @@@
@T @
R @ X
0 A P R TAL
X0 b@?" W
h
0- @PPL< ,0 T0,0
T0 K0hh
-PPL ` p 0@@
R
@
P0 S @
Q@ T
?"
P P @0 0@9 0 X ( Q Q
0" h
0- @PPL< i0 T00
T0 K0hh
0-0L @ 0 #*0*"6< $0 00 0H0^ K0h0
- `Q`0L P#*0*"6p A00000P0 0P0
, $ <4
$ 4 Kh
-LlM0` S }
1 * * 0" q P뤠 @ )
0
P X
0P00 @P^ @ ]
, Q,#RↆU
Q@ T
0HQ0 I Q
L
@?
Y<
h @P
7 @xp Dž @ T$ 0@
d Rd #K @P ڈ KI @l T
00 T 0 S 0@
@ @ - #@ (Kh
- pLtM@P`0 : :#t2 0 hq @ p
N
T Rxi R&
T P" U d Rd #`` V`! K Pv O @ 0` `Q
V`K
P`K
q PP? @ ` H U
TT n \! <i ( 2/ PUp R+ d RP1dP# V Kⵅ P2 @
`K R P R
( 0PP@ 0
0 WPP#@
@ D4 4 ' Zn
0
PP (Kh
-p` : :L#(1 0 Q A@
0@ @
R
0
P R 0@
Q0 S @
0@
0T 0?o2 A P0 RT1#400 S@
0 @
T Q
X
, h
0-h0 PQL 0 A
T u T
0 S|A@OoB U
@ T@ 0
-aL P0 S4 @ P ||R 0 U T@
ጞ pDB0 T U@ $} T ! {0 p@ p@ i
j 0p X& T a `
, g x 0A T
` L
TH ! 0 a; 0^+^
- J0 JL$F p P x0x 0a P|A T
X L0D |1p000 3/ T1;T1@P@Q@h`fU
Q0-L @0P 0$ 0 S @@ 0
0- @L $ T@
0 0褨
-P. @ S RL
": :d #&`0 0a
$ 3
, $ 4 + Khh
- J0 JL$F ` pP PM 4]01 01 @0@ `p1 H10L10T1K St T1 S 0 00 k0 $@0 4/ p @ 0 m p @
0
d1 R @F
Qp T1
0
1 W 0C W15 : 1 W
d0C W
00 S P0@0P0 H1<
e1 Sd1 00C?o2 @
S
P0@ 0 0P0 S
P0@ 00P0 @ $K`tpUit_t f@ht
tpt u ut\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
-P @`L S V `
U B I 0 0 0P
0- @ L P
7 P
0QBQ- 0000
0- @L0 S P!
\ P
00c S 10CB>A>A0BQ3 \ 0 0 0 0 S 00 000C S00 0 0
-L P``p V0 S 0 0s h S T @ @a V@ cx0`dp0d0 0@ 0 @ T0 0
- PL`6 ^@2
V @@l T @@l) 0L 0c"
@l d R 0 S q ! BB.A.A BW" @ S
0 @ S
d R
0- @PL0 S 000 0 R 0 S0l0l U0 cPc0 S 00 0 U R K0h
-@L `0 P S S
0 S P00 00 ` B Q
1
R S0C>ౣ>! 0 3
R S0C>ౣ>! 0 300 0000 S000 F^
-L M `Q p@ ] x0 0 ST
S+ 0 S
00 0$ <嘰 PC 0 P PP` P`0 UP pw R 0`ep000P 0P U00 V& 0 R! C0ࡁH
P ⬑5!0C"!'*N 1 0c 00 Z
000 9 (K^^- 0 S0 0 Q S t0C S 0
0 Q ^
00c S 10CB>A>A0BP3 ̌ 䨨-0l S 0
0 ^
0l S 10CB>A>A0B\3 , 䨨
0- @L R P
@ Q BA0 \ P
0n S 10CB>A>A0BQ3 \ R 0
0- @PL p
040101l
10 P
ᕐ /0 -P0 @l
P 0 0 e
-`h0@1L01l
10 P U
8 ᘅ 0 я @
-`h0@1L01l
10 P U
8 w 0 ᘏ @
0-L0@01l
10 P U
0 X @ ّ 0 0
0-L ( 0l !
P
| Q
Q h@ I0!100 R0 @@l l 0 K0h規 0 0at /
-P GK
QK PK) `P 4 30 P S
1[ S
(G K p 1
H1 S 0 S `1HQ :1 C K 3/ P U
P
$ Y Kp
0-L@L (PX^ U^ 0$ e^ 0 K0h^^괨؍ULU
0-l LP00P0\0 @ T
P0 U *$0 S
3/,PX@ 0 K0hL^괨 ܨ
0-p LT00T0`0 @ T
P0 U * 0 S
3/,PX@$0 4[ K0h(^괨
-LM" Q"
"
R 㴢 c @ P 0" 2 H `P H 52 @22 T
00 S
(0 S P U
1" R 0"0 0 R 0 0 0 0 P `2 Z 00 Y 0 Sw
p 00 000D0 S00 0`09?K
- p2 is 2 " @ Q0c"Kd2K
K BRB/#s0 S
Q
WK BRB/#s 0\1K2[1K K& A 0 K ?K' 0 A 0 0 #K
-㌿ P y 0 S 0 U
2
J
=2 0Is
@YP< ^2 2 S22 H (K- . G- Q p Q@P`0 @ t GuI Q G 0
00-X00L @ X # R|01X 0 S
3/P0 U * 0 S
3/,P<0 R , 0 0 0 0c 00 l\tp
-LLM0 0 @P pl!2 000,P(p$@ @@ @P `hI 0!X2 0040P,P(p$@ @@ @P `I 0!2 0040,P(p$@ @@ @P `uI0 00 0!1 004,P(p$@ @@ @P `p`I 0!h1 0`108040P,P(p$@ @ @@JI 0!1 0 108040,P(p$@ @ @@ 5I0 00 0!08400,P(p0$@0 @ @@ l I00 S
pPp`pp U * P
0" S @
T
(Ko(Kn^^^^UWl^!_!_# P 40 1X0 S $0 0 S
PX0 /ᴨ
-L P0
S * a o R \ ,0
0P0-L@
P0
S * R T
T \ R P \ ,00 0
0-L @ P
@0 S
K0h/ 0
0-L @ P
<0 S
K0h/ 0
-L PL
-L P
K h @ P0 ӗ /ᐜ]
Q0-@!@3 PL PP @0
-L 0 S h K hqꨜ]^
0-L P @K P
H0 S
K0h/ K0h
- p0 L P
c2 P
D0 S
$Kk/ P ` U 1 ! P
@ T w P e舀 X h b R ! w P @ U 1 ! V ` `
0- L @ 0P
K0h0X
- `PL@P ( Kh+0 S
S
S
S
S
+0 P` S @ S
S Kh S
S Kh` 0 KhǪ Kh Kh 屪^^^^^^^YL^^
- `pL0L @ T
P0 U *0 S
3/,PX@
- `Qh0L p @
T
0 R
X@P0 U*0 S
3/,P 808 0 S 0 C1 S 1 P # /ἼT+ 0 0 S /
-L M$0 K@ P K茵[
-LMP`K p` @[p 0K\0 B R- : 00 00 0 @` 0 0 00Oo0
0BB P@ T$ Q 0 S
S
S lP 0 Q Q T <0P 孤 @0 00 00 0 堤 (Kp0]lh
-o pLMOK op 0_Kd$02 ט` o0P 0 000 00|B lb 0
0B(K0U\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss
-LM P0 @ T
`0 V *(0 S
3/,`X@U P! 0p("a!(" @ T !(210#(2 OD T
0K L 0 S
3/ 0K ^DUT+]
0- @L ( 0 00K0hn P 0
R0 / /0 H0`0a aa0 /
x00-tP Q @d L 幢 PT
0L00+40 400 0P0X0 0H@ ` \00 0
- L$M p
@Q Z Q
@b Q
T a 0 0
֧` V T
f a 0 `0
P ŧP 00 Pa UP! m`e @ 00(KD^_^^ P@-A
Q 0 ࠣ R S S c0l00 0 c(0a & @a 0 ^ T 000
(0(0 (0 Q 0 c P P00@-@ P 0 00H000000
- @`pL Q 0 Q c @P0 Pa UP! 7/ P @`e V Q Q / 0l S Q / / /
0-HPL @L0 S 0L0
L f P
T ' TH
L00L0H H@ 0
d T\ ݡ X ^
\0` T K0h /T B 0 10 K0hơ00
-L Pp!,@ `$ȕ1$͕ Kh10
0-X0 PLP Ht @P
0 H@Q0 00 0 00
- `p PL 0 SP0
3S H L0 S T0@` 0d@@d@ 0 L0@c T
T@0 +k0p00@d @ P
T 1 # k0 Pp@c T0 (0`d`(`o
-L P
H0000 0 0(0,000$0@0<0D0
0-Lz @P
l 0
0-@L W0
0 P0
10 00
- @RLd`
80
0 P0
1 U@0 ]
- @PL 0 S@l U2
0
#R
PH L R Q
3S H L0 S T0a`0 0`0 000c 0 S0 k 0 00 P
- @L 0P 0,0 S * 0 S
QpPb@ : U pP
0
/0 嬠0c,b0 U` X01 V`!0 k0Pff0000f S00`` p @ T U U @ p 0
-L M p P U PZ ` Wpf P S`g&
0 #
0 @P
22(00j(0((0" 0 V f0 0 07 P P . *(+ V 0 `P&
V @P
0f 0000
\00 00H L dH0H0 2k` 0p 0 0 0P (K 0
-L M r8 p`<0 @
`0`(` S 0``g 4 R0@0 8000 0 W00D0 5 pc 0 S I 0 1
3S
W PP
W 0
T000 V0`0040 T
0
3S
!1 R Y 00 @ P@ V PPUD0 UP! S
< j<00<0 p`V
P U p0
fX PP P \3d @ ( PT
0L00H@ 40 400;`0 3PPXP 0\00
3S" HL0 S T0 0b` a 0,0 c R R1 0 W 1 ! j p
i\fX i b P P~
0
3S HL0 S
T0 0b` a 0,0 c R ! W 1 i P0@ @+H0L0 S9g 0 PP 7 T PF fV H1d 壞 PT
0L00+40 400 0P0X00HP 0` \00 ;0H0L0 S( 40 Y 1 S
40040 0 h0000h S0 00 @ Y0i 0@ p 80 0
( Z((K 0
- PLM
K K
-LM00 0 0 K ` ]
-L P` @P 0
V0f Ó0 P`00
- rL M80 00? P`
Z Q0p00
p Uh
0 W pW P0 0 8 , K P"< 嘢H 8 @ D0 f@ P @
D0 S
@2 00$ H0 v0(0(`0i (0 v g
R ! 0 _
0 S% 000 10 00H L bH0H00 v p`c0 W p 0 P v V QB
U v>
Hd < 吝 PT
0L00H@ 40 400;`0 0PX\00 <0`
3S H L0 ST0` 0`0 0 v
S0!0 g R ! h0 P< 02002 0 02002(K^^ 0 ^
-L M ! K
-LM K
-pL P @PJ
$1 00 0 $0& H 0
00 00H L %bH0H0 wh P U
w `P
` 0
d00 00H L bH0H0 Xh P 02002 0
-L0K M # W @P @ 42042 K0
0b S-L Pp9 : - @P4
0
0 | pb,b0 X`! W01 V`!0
h0fpf0000f S00`` P U X X P 982 0820
-` 0 RL Mp00 pA0@0 08 P P8PG @Pf
2ᜡ(p20000K<0 W0Y Y
@P Q 00@0`e V`!fV% d 7 PT
L $ $ P X H@ `\ h ) V1# V Y <"0 X000`0 S
3/ vg<0@ P @80 R<@ phP (K0
-LM K , 4 P
K
-L M 0 P SI
N pP D
0(` X@`c 1000 V d 0 廛 PT
0+40 400 0P0X0 0H@L ` \0 0
V + (0 f0`c V
0P 00 U00 0@ M p (K 0
-LM P` ɠ R @ 8 0 V @`c T V 0 S @ T0 4
0Q HL Q V P8 pf
! R P R 0 P
0 S `` @ g ^P R8 \V
4! \
0 \ HPL \ Tl` c ̄ n \ \
0 \000 u 0
3S
HL0 S0T0l H0 0 0c 0 S Q
0 X 00g0 000 0 Gf0pgp @E 0 E0 P P R 1d 00 庚 PT
L $ $ 00HP 0P `X \00 ) P'
p f0 pgp 00 000 ' 0 0 P@ ` Z `(K^0
-L `
a P @!
P Vd h PT
0L00+40 400 0P0X0 0H@ ` \0 P 0
0- @QL P P
P@0 0$0 0$ /$0 S 0$0 / Q0 /
0-L K0h
0- @QL P $@ T
Q
K0h0 R$ P
0 S / /
0- L @ PP
he 0
-@ `L p$P U
@P V 0$0 0 0 @$@ P` 0$0 /$ / / /- /- / /- /- /- /- /
0-@ Lv t- 0
-Lq
S-P1P!L` Up@ g \
U l l Yk P U:
-L M 0 ` P 0 @p P( X01 0!000 0 0 P X h
Y 0
0 0 P
Y
i 0 P ` e (K- /- /- /- /- /- /- /- / /
- @ L`p P \ 0 Dd Wp
d UP
d`
-`@3LM QpP
1C Q
1C Q 0 S
09 X@ ^` 80" @ K P
0
9 0Sy HB T @
D@D T
K P K H@ အ$2 W2
1C W
1C W Po D K T0 p HB
T
D@D T
00 S
H@ T ] @Q (1 S9 0001 S0:0 j K T>
(1 S=
01 S:
0 K G @P) T K G @P P!
K. K ? 0 (!P0R0%W
( 0 4P 1P PK 4 U @
P U
5/ K i
-LM p
PPP ` @P
00 ` 0 PP _ (K
- @ L` PPP U zc` P
0- @$ L P
( < ޅ H010WK0hH@G
-PL` 00C S0 @ ,0 $00?o2@ T
-@PL` g b$00 S9
(0 S9
:0040 080 0 0 '0 0'00P 0:0? `P@@
-@Lp` 2(P$@ q U T
Khk
0- P<0L@@ T
$ [a P @ 0@G
0- @L ᧸ P
K0h 0
0-L @Pᙸ P
(0 S
m @ @ 0 0
0-LM PK @P 0 sT@
0 0 0 S
⋰ I K0
p-L M `P $K P $ @K 0 0$ 3 ឮKp
0-LM PK @P $0 S@ @ T@ @ T
ꦷ K0
Q-L `P
0@?40 P >80 P
- @QL `p
4^ P PE P 00 / R0 S
/ 9` PP ោ P0W[ P 0WMG Y#
ፄ < ㈄ @ 4` ♯0$(P 0000R 4 8 [ @ ? 8^@G
-L@M @P
T[
o q
@@ @@C0 PPa
奫 9; u @0 0@ p`0 T!(0 0 (0K0p,`$@ @@ @ u81 0 0!10'>( K0,p(`$@@ @ a80 0 0!0,p(`0$@@ @ 0( K O8 d 0 PP L` P U
@/
4@ J : $K@G ]xtU+^=^|C^ HJ^
-LM ` 0 ,K 寱 PP0 , Kb @P P& P P 0 PP`
p
P 0` S @00C@0p W,00,0 W KG@G
-LM `0Qp0 K(KԸ P @( 00 $ K(00 00 0(0 0 9/ @P p0 l00 R@# *0 p4 K @P
( 0 ᑸ 040( 0 $KX]@Gx0 l@
-L4M ` 0 P<K 0qL0 ' P~ @KH K⋸ Py H0, K( ! @0 0 03/ @Pd ⨑ 1 P0 < K PP0 & |1 0 RO *0L K<K 0 0Z P
@G +
@> 0J P.
P U0 Z @* Q : @ L R @0@0 @ 00 0L0 H@ fL P
0 P00@ @@ H (KX]@GxG
-LM 0000 0 0 ^ K l@
-PLM K `pc P, 0 P 00 S
$0K ǡ @P $ @ V$
#@ T 00C 0
@ @ { ᰵ K 0
0-LM@ P$K P K P 0
,0 Q $0K # P< K0ɚ; 0 800b80@0
0- P,@L e ⦭ K0h.ꄬ
0- P0@L $0 P O K0h ꄬH
-LM `p0PK` 0 @0 _0KT0 0P @ 0 0 000 0+2?o2 P0 S
$KX
-LM pP`K` 0 @0 i_0K\0 0 @` 0 0 000
0 2?o2 P@@ T 0S ( 0 02 (KH
0- @ PL l 0 U
K0hD 0
0- PD0L@ \0 U0\0
U0 \0 S0<0K0hI
-D0QL P`@
0 "
09 04$0
L Q
< @ R0P P PV
0- PD0L@ 0 U00
U0 0 S1<1K0h
-D0QL `P@
$? R" 0` `U
Q00-L @P0 " P
P 0 0
Q Q -L S
S S
S L Q
~ P
B R 0"90 S 0 S
\ ` P / 0 !`8 0 0 , , ! /hsss 0A @-
! \ *! $ R $ R
@ l d R \!
$ R
X R 1@
-D0QL `pP
00b a S ?"A
09 04$0 Q @ < @ R0@ @ @W
# 0!< 0`4 0 , ! /hsss
-LTML0 ;< P1\0 0P0 0l0 @P00h0 0@0 0Q H0 0 00 S 0 00 S ppp0,
@ gP0 0 <03/ ` V <0< 0 Q!mf ` c<0 @0 S
?o P2 0 S TG
D L R 0T 80$d X x0 0` 80 0PD0 ( A T
VP <0 0 RK * R :@ F
SC 0x S R<
L0 S
T7 4 S4D0 DD0 D ! 0
T) Q%
" 0 S 00 <00 S
B
8 8 C @P
@ PT ,7 \0 S2\ 02P0`0 3
H0 S
0 FH0 @# 8 H0 S
@ 0 1 A @ 1 S` a 1 S 11d
X0d0 10@ d0
0@0 P00 $
1 S!
H0 S
0 H0 @ 0 8 H0 S
@ 0@ 1 A @H0 @0 T 0+
! R# i 1 S Zh
0 S
0 0 @ T Zb
e ` 0 Xi T 0 a@ @0 `
1 SX0 p p`p T
<0 Z R
1 SX0 S
S
1X@01<0 Y 0
`0 c R01 0! g S1L0 S<0 i T ^ < e T Z
l0d
8
00g S" 0 @ p< 8 `PL0 S
@L@ @ A @ T
V`A% V aaa p L0 S
0 M P 8
0
D L0 0 0000i000i0X0 S
i YX 1@01X ` S` P
N
(30p0 0t0 p T R@
<0@ T<
@/o"@6
L` V/ / t0 S
` l R R! P0
R
8@ \ 4/
8 ( T 8
P A T`` ` `@ D l0 T 00 Sp
p 8 T V aa
0 S aP00
0 S
P0\ 0 803/<0@ 0 b/o Q" R
1 8
0 S 0p0 p 90 #0D0 D 8
uT QD\ Z ,K0(8 Z 0 1 @ A 1 S` a 1 S 11 R 0 @0 0 00X0 0 Sh0
X0 S R
>T h0 0\ 3/ T 0 0 R
X0 S R
h0 2/ /@000 S
(K
-L p P@ 0` 0 S ➨ P
@ @0H 005 T
808 ,0'&J @P 脬H4
0-@ L0 J K0h
-L M ؐ p0 P U(
븠H 0` T@00 p. n@N`@@f $d NN %00 PS$ W
L ꄬ[H4
-LDM @00 X P 000 0 Z8 0 ( Y p !@ ""2@0 0 |20|20 S`0`30d0 \0d D0 Pn !0b X4a
00
?o2 Y0 S
I X0 SH
0 c00c P 0 \ 8 ; P
Q9 : Q7 : S 8 Q
0 S S
0
( D k . D P+ q0f40 Z00KP0
0 0 000 804 R 00 S
0P U 40 `(P P 0 `<0 40 Sy PH 4 R U 3 Rn
4 0T0 0T 0 Sf
40 UP!UXH0 p~pp~pph 0PL0 P
H0 d0 %K P'v
L @ L0 W6`0
H01d j 0 ` *T H0L 0H``P:\@#*0T L00P L#4004X 00 0e0 00 0 00e0 0 R0 000C0 U40 0e40 $ 4 fY 00 R 0 S
0
80 S
00 S| 2 0[b U P00400e40
a P0P `0p(0P(P P XJ YP` 00 000
1 : @ R! ! Y;ö1\0 S 00
D0 0 3/ 0 @`X 06/@0 S101 Y1;ö1 0 P00 40 Y S Y ` p
9 ' ( # 0D = 0 P
0 S
Y P[40 SP P<0 UP400e40 80 S|
00< ?o R2 0 S0e 000o (KH[ U t
I0-L8M ,0 0 @` '~! 1 Q 00$@ @ @000(` p #/:0 ,0 0!0 00$@ @ @000(` p / p =`@$ \ ХT ͥC { P
4 00 $Kk֡UV^hU_^Xe^k^t^xU^
-<0ML0000 $0 P
K ^U^ P / P /
- P@L` 0 Q
)/ 00 3/ @
- @LP1
40X a S 01? S 0!t4 00 03/ PPa t H10 1 0
00/5 / 000/!
00 0/9 /% /
-1L @ P` 1
0 Q 0 0 Kh/ 00
8 P- /
0- @L21 <1X V T K0h
p-LlM @` P+ 1 @01 d KSW, V0
00 S
z04 03/ K Kp
0-LM @ Q 1 K0h`$0 S
P
0 S
1 < F0 S
1 < E\ H1U S
9 U K0hI K0
-L M0 @`P 0 PM U
P P/ ;
_o VR P U
) 3 0 S + . 0 V 0a 010 @41妞D<01 Yx0D1
` ` 0 0 3/ PP
1 01i L @ (KUU
-L$MQ `0 K8K@qJ 0P 5 $. 8@0 F !$0 @0 ( 0" p
04Kq @P
18 00 40 X0!*!0008 10\ V408 00 (K]
0- @5L05 00$03/5 P0C8#85?o2 P0 S
h 0
- @L1
,P U 4P U
P U(
1P
1 P ] PP !00x St`
1
1 PP
0 S
0 003/L.1 01
Q-L P@ 0 ` q@D T 0 0 Kh/
- @Pp`L nU p` Kh
0- @ 0L P
*x K0hVU
-0L @ S`P
0 U U P P
-L 0KM# K
-PLM @; T2 R
0 S
0 S
3/ 0 SK
SH
SE
C Ru @ S0 S4
S9
@ S) S5
S% ! S7
B S?
S
B SU
X |! S6
SM
P `! S
B S- B S
S ?
B
S@ 9 1 30,0 1(0 + ! * ( 4 S$4$ 0 P4! , K` aT|0 p< K ( T0 0$ ,K E ] P *P K 0
- QL T
-L$MP3 @ Xp 0P@0 UB
U?
U<
U:
U @ U6
U
U 肟 U
U< U+
U
U 2 U 0 Ub
U ` <K ` P V 8P U !`~ \2 ; U<0Q S1001p @K ` 5 Vh @0 S1PPQa @K ` & VY @ Q`U ڼ1 U
U
0C U
\ P0;0E 7`C P1;1
; 0 S@0 5@005 0 S@0 5@01/ <K X ` V& ܃K40 L0 2; bH
*; P 0H L0(( 00 X 0 S0@0 0@ U@00 1 *`* V V 0 S
0 S
3/ P `
* P ` , (K
-@L M, K 0 , K6,K @, K K
-@L P@`0(@ S 0@0 S
0 S :0 @ P
-0L P S @P
0 S `d ! PT
0L00+40 400 0P0X0 0H@ ` \0 ` R |S0 00
-L M @0 T ?$ Kh趹
0-@D0LP 0 S
S
\0H0\0
1 H0H0H00 0 X @,X v 0踞]]]
-L @` P PP
H0_101
$0\V000 N 80080@0<@0 H ` 0@0 / 800b80@01ở K0h101
0- @L䫟 ⩟ K0h襟
P- L2 :@̀P`ap V ʀ 0 ! `! 0 , !|0 , 0Od0 0!!`a0 ! hsssX
0-LM PQ @ l00 U`0<101@0) <M@ P
00PH 0 UDPD0<0 RH0K0谬X
- RpL P
0 (0 P` V
0 0 S`8 <0@ 0bD ` S0 Q < 0 @P
P , PT
0L00H@ 40B30 0P0 X0\0` 00 Q V ` 0 S
`T0 S@L@T@P`
^
- `RL p$
0 P 嶊 X` V
D @P%
P `( UP
( @@PT0 SPLPT@ 0 S@P@ @ T@ zP U@7 ^
- `RL @ p0 0 S P0 8<0@P0nDe S0 R P 0 S
b P_ T0 S`L`T`PP^
- ` @PpL T^
0 0 R` V
0 S UD
01 Q T0 T 0T04 U8
0#! R Q.
3S H L0 S
T0a`0 0`0 < 0a 0 S 1 Q 0 P 00080 080 @ @ L@P@ 0P00 0 p@ V
U
0`` $Kk^
0- @LP L0T00
0- @QL P
T0 S@ 0L@T@ 0 Q
0 00000 K0hb0 Q /T R
0
0 S
TQ
- @QL PL`L0'
S
Q
Q `0 R 00 0 S 0T@ @ 0 Q
0 00000 Kh!
-L@ P T`ppL V( T W 80 S@p0 V 0f00008 `f8` `c^ 7 @0 S T - @ T
L@pL0 SP0
R T0Lp^
0- @L@0 S
8 0
0-LM @P1 < < > 0D0K0
-0\`L P @ U[< S!p P
P
1 S010 SP0 R0 7 P
-4`$0L? R P H1 S, =
P;
(!<0 R
0(1,11:11 01 1
` @P#
1110111101 0 044T0T001014141<1<1D1D1 0 0 P
0! 011 1 1001>010 >00 00 03/ P V
1 01Q r
0-LPL @ U0L0 L0 SP0T0 l E PP0
-LMP U `` V p0 40
``q R ] @PL
U7 U W PT )
0L00H@ 40B30P``PX`\` 0 Yd 80 廂 PT
L 80H@$ $ + 0 P`` X`\0 ` 0 00P 040 000 0 M g M (KȞ]^0
p- P LM K` @P
M Kp
0- P@L 0 T
X @ 0
0-X (PLX @@ , \
w ꋛ 0 ` T
-L t
- 0L P i
0- 0L S 0 @ @ K0h0訬
- `pLX0 0X0 W (@ P
@ [ @ 0 U
T
# X0( 0X0 ]
- P@ QL
) 0 ` T
t 0 0 S / $N
0- @ PL 0 U
K0h[0
-LM@0 0` 0 (K : P# r( 1 :1 PP
( $. WppAD 0@ @ 0( 0 0( $K]
0B S0- @L P P ( 0 S 0# S0ĕ P 00,^
-LM 0K 0@ L P0 0K
p-PL M ` K @ P @ z Kp
0-LM P@ EK P E/K K0
0-LMP @K ע P @ T K0
-LM p `8 @k P
(0 S
?& 0K4 KL PP
6 00 0P * X
A q
! p
!*
$ Rl
,k @Pg ! Q D T
5 $D T
$U R
m4
P p!4 0 ( P Ġ4
8n @L墖L T
4 V4 00 004 '10 0巣
00 #. ӥ10 40
ᵡ -@ @ #@ @ ᩡ<00 410嗣 X
(K_]
p-PL M ` K @ P8 1 %@, 2 @P 0!00 S
1$
R M 0 @1 P
p P
0@4 101 t@ $@ @ M R Kp
0-LM P@ EK P E/K K0
-L4MD1P 10a 0R 0p 08 K@KH 3 P= @08 K<K@80 40 @0H & P) <0 8000 P U X 4 Ko P 0 < P4 @ L 0 < 4 @ߢ
(K
-pP @`L W
W
T
0 R
@ R @ @D@ @@ X
P
U p
-L M 0 R XpP$ ``0 R
@ 00 ` V00 P U@@d X U
@ T R `
P
0 c (K 5^
-L|M Q R P Q
O 0 X a
R R(P m p lpK R p 唕 PPt lpK K0 x D | t R | | ^Z PX ! P
- V @@ T
l @`J|0 0
0$ 00 K4Q 05/ |0 P0c P S 0
p P # P R+
T TP
P R
P l U
@ 0 r 0 X @
@ Pl0K W
l T (K@^$N
-PL M @ K `p' P 0 0 0 00 p0000+ @ K
0-LMPK P
@ ~ 僟 K0
0-L M@P T
T 00 R0 S ' 0 K4K Ο P! 0, K T ,K4 40 @10
. 娔 @P ., K H K0
0-L(M 0P S
4K 叔 P
0 40 8 K<K 唟 P) 40 S % , K80,K 0<0!++!< @P 40 S
S 10 倕 @P 0 Kz @, K K0
-EL$M@ `Pp@X d18K10@ 0 D P @K 80 `4K0 09 `P> 4 0K@ K1:18 1:1 `P/ 00 А 0@00K< K 8 ( ؠ `P <04
p p ( 00084 r `4 V < @ ꜠ @ ᘠ4 8 @ (K]
0-LM@K P P 1 9@
00003/ @ z K0
0-LM@K P P
k 00403/ @ ` e K0
-LM pP`P@&
C 0 0
K ᧓ P R@ U P
0 R 0 H 4 ᬔ P T 0 0
K⢔ @ K,^
0p-LEM @K 1d 000 0P0` P
0# @P
P 7 P
ᢝ Kp
-LM p @ PP
K KT P KK 0 `K 1f000 0 P
0# @P
P P
t K
-LM pP`P@&
C 0 0
K " P R@ U P
0T R 0 ' P T 0 0
K @ K,^
-L R< P V @ PT
0L00H@ 40B30 0``P0X0\0 ` 偑 P
L \0 U @
0 R # R Õ `
R P ܞ]
-LM 0 P Q R0 0 S Q
0$ $ a
R R(@ h p lpK 0 S p , @P 0lpK0 0 x0 0(K 00! D |0 t S | | \ R 0 Q Q
0 S0 KN @Pb Rm 0 S
1 P
0 K; @PO V PP U
Uh PE00A Q00 K 0
0|4/ 0 @P0 |
X
t T0 0# T0 S T 0 0 0 Ā 0
@0b U
0 0 S
0 @ 0 Z
hl0K W
h P
P
@ (K@^$N/
-`L$M pP,K( K ႛ @P
0
0
0 00, 00 0(0 @ K
-L8M0(0 00 $0 00K 0 0 0 0 0 00 0 ( K 0 , K
p-L4M@ P`8K / P 3A 0 08 K Kp
-L\M h `LpKT KXK Pp ! @P : 0P S;#d0 043`0 d0 U(
兢
P P0` P K ` 0 T0X h P
PL 0
00 PP
@ P僚 U (K@^- /- /@- P@ U$
1 S
S 0 S 0000 0 0 H ` p` P00 @ 0 ! 踬
-L M pᜠ W#
P 0! R
P Up R@
R R ``F&a R Y40 00 8/0 40 (K
0- @PL
4 80( S 08 @< K0h0-
0- @PL
P 0
(0 S( 00 0v) K0h0踬
0- @PL
P f40 0C40 b) K0h40Ȭ
0- @ PL R 0 U
K0h*0
-L M @P }s=`0 S 0 S
3 姑 向 P U
<08d80f X
H<<3 P P U
&*& v X P2 000 Zl
%) A 0 Q 0 Q
4 Q
8 Q (( Q
P U
H2 P : Q
@0 0 f !
᎘ Y000 000 , X
l<4 X
H< 00 S X 1 P UL
(0 S
00 S
8 R 4 S 00S
P0 S000@000000T 1( VP U000 ^-̬ .MV R 0
0 S
0 Q C]
-L
-L
-L0 PL @ ` U
0 P KhT踬
0- @L P 0
-p1!L ` R, P @@ 00
01x0D0妊H 婊@0L @
D0D0H0H0L0L0@00@01 S
S
S
( {|0 0Pz ) ^
-0L P!` @ pP 1 S
S 0@
D D H H L0L0@00@0 S Q
0- @ L P
P
wP K0hd
0-@ L - 0
0-@L 0 T&
! R
R
R S
R P | S 1010R 0 0K0hL0^
-L
-LM @p$ P
P0 P ( K P
01(`x0 0 0 U P $K
p-L M1 P S
S
S $ ! `0 S
@ ,0 ! b000 1,0 (00b <00(00M
\ P { Kp^^
0- @L PN$ P
0 0c * 0
0- @L 0 ! R
R 0 S
P
T 0
-LM @ 0` S! P} @0P%Py 0@010 00 1 u gA 0 PL `P[
00 X0 Q 0 a U CK&" pP) pC?K( W
\ W (KȬ P / HMV
-L,M @S `8
p0 S 4 R 0P S SPP U 0C#1$00 40 0<0 4!4 " D F0H @0 00 S @0p@0 7H0 S *Tx##p4P
P
(0 SP
ph#4P P. 4 PPp%
#>
0@0 0
p0 R L0 D0 7 ! H C@0H #0 04@0 4zL00 p 40 Z
<0 <0 奓 W
*# W! 0
8 @0 L00H@TP400040PP1 0` X\ 0 p W 1 S
SG
SX C 80 S1
8p 8 pP
9p ) t 0 S=p!
` P!@0 V`
1y @0 B P
17p0 1 3 p80 SK
'H 0 SD
@ P
@ Q @ T
P @ 1 S
S r # 0 !,0 b0000 !, 0 (0 `1 </,0 ( Tp
p w9p (K \Ȭ^]^
@ -L P Q v ^ 0( ,ଃ( 00 -ଃ ` 0P
t R u ` / /
0P -L
P
- QLM 0 | Q e00 Z
00p 0h W0 01h0#0 Rn _ WP Ui a0嘠 @ Tb
W X R@F
0 K$ K ( K 0 KKK K H K K L K K K♈ R 0 T
00S0
9 0g HrP@# L ) 0 Z\ P ` R (K䬃謃H\ ` P / 0 !`8 00 , , ! /hsss 0!< 0`4 0 , ! /hsss /P 0%h % # 3 /ଃ T0 R 2" 0@- 1# A@T_ A P 0ଃ
0-@LP P Q t00_ Q h t_ P0 0 SL P `< Sd pr h0 S P 0pଃ ^^
-LP'30l %l 5l !p ଃ
-3S#LLM t x 2h0@ S 0 0
4 4K0 K * P dcu PPT3 0
S 0#0380 0003PP 0 P0P n0 03PP 0 PP0 n pԒ ] X(5"0"< 8u8"`
X Q20 P㗖&0<0nF 00 P P g |lp l W` 0(`V P l B 2 SL0 P,00 ! !(00 0 0P$` ` ` 1 0 0@p'!ထ1 000P,p(@$` `@ @H1 0 0!81 000P,p(@$`` `@ 1 0 0!0 000P,p(@$` `@ 0 0 0!00P,p0(@$` `@ 0 P }(Kଃ V3^;^T+^[^pa^h^tx謃 P0`p
@ n @P
59 0H00 XA
01!,10 R; i0 300
00 >
0 0t0 S $ x P x x0t U
t o% $L t
܆ଃ䬃l
0-<0 QL P m @P
6 UP 00 0ଃ
0- @L ⨆` K0h褆
0- @L 0 K0hmଃ
0- @0Lh垆05000
"0 0;0^09 Q
*
# ! R S 0 SS
0 S ڤ0
1
P P
80 3/ 0P
= U0
% $ 0 S) 188@ Q < 0 0 000 @ 0b 100` 900000[ 0 S
l0 C Sl M 0 K0hm0X ଃ謃
- P`$@L K Kh䬃
0- @L v0
r<00 0 E P U
0 0 0K0h/0
K0h K0h^
0-LDP A T
0 R01 K0h
0-L @Ḃ P
0 P 0<0! ! @A(0 K0h K0hଃ
- `QL @P
0 Uf
QP
$00 Q 0 S ; Kh Kh3
-@LP` T P $0 S@ @ T@ @ӛ Kh
0-L @eE P K0h P
8 ( Q
0 3/0 p 帿 嶿0 00T0!x20x2# 4 妿0 <0 K0h䬃
-`L @ V
t0 S` o P
9 S
8 (0 R
P PP0 0 P 00 S
(0@
P
U ) 0) * 0* 0 00 60
[ Y0
=0w# 唿 0!x20x2 I0
=0 VT00T0 僿 U00 0 R U ` 䬃
-L $ @P
XP `0 V0f0 0PP 0e 0 0$0 ଃ
- ` @0PL T p0 R P @ ଃ
-LM`pK ` @6HQ\ 0 R0 KK\ \ 0p 0
@ 0?o2 P0 S0 0 R 0d S) 0 0p R l a Rp l R p b R lI T 夾H@0l S ` P$ ۾1 (Ktpଃ䬃
-L M P `(@ @T bo$0$` `00 VG
p17' tc 0P40 i _ P ! Q ⡾ c !x R B!Ƀ ┾ Y
V 1 !060p W
010# d40 @(009 l @f @ T@ s P3
8 @00 4/ & @pp Q:l Q 4
St
P@ @ P Jb!"R(# R ! R! \(K^pଃl 䬃4
0- PLp @P
0P :0H0$($H Rtt xx @0 0 ? 0䬃ଃ
-`0 @ LPp+
Q(
50l0 V0l0
U `
6 l0 P C Sl SL0 !j V
ᗽ U 00 l 䬃ଃ
-L P`pၽ) 0 @P
0 P
p
I 0P. j @P
0 P
'0E( t \txA(8@` 1x0Dp`p8`$@ 0 `@ @00K4 K (K踵^^^^^
- @PL,
0 SP`'
Q
0 S 0 \P V Q
0L S 0 \ 0( 00 00 0`0谶
- @L P T
L` z
04 R00 0 C \ 0 0踵
- @L ` T Z @ c- 0 SxPz 0 S0
Q 8 Q 0 @ @
0- P$@L ẵ 00C0K0h꠷
-LM#K0 @ S 0 f
0 80 Q
0 Z cK S RT
Q
cK W V0 S 0 ?\ a0 0 S Pzt00 0 0 P S 00 P0 S 壵 bZ P ,#K 00000 00 00 00 0000 S0 80PpA @(K谶
- P`p᐀L Xh 0Z @ ,0` 000 S0 0@ 00 000 00谶
- @ L
< 0 0P1 S
P ` W V R 0 00D 0C0 00C 00 0C0 0P$Kk0 f^
-@ 0 ` S LP 0 0 0 P
Q 0 S 0 S P
0 S 5: / / P /
-LGMp 0`01 @Q P8 0241 01 1 @ TP4 @ u6 s6 < r; W 01 T0$1 5 1 SPi
C! / P C] 4!$ =E P] 0$1 L# 0E/KF K P0 G H; 6 1 S C! / C 0Q1 00C T S00 0; 0
T,
`0 6 X(
%6 $; P
5 P z
5 t0 S 0 W2 1 $
K E P
5 Z
P P V V
! P
5 U
5 < 1 1A/KF K0 1 0 GD 5 Z1 01 : P W
*KPO K U\ N 0
K K C?K0 0 0 KK?K ؠ .K Q P 3,0K# ! K0F X P 0K K ) P- .K K K b X ڸ ^ ^ Q Q
O?K S R
b W"# *
]+ n 1 S
Mc ?5
(K ]
-LM 0 , o K 80 01 P80 o / Q
/
-L,M@
T8 < T . J M pP, KE"pE0 `8 @ D 00T3 00@ p W 0 <0 ` 80 w p gM " (K
-L MP00E40 0 `p0E 9 P8 04 K0K D @ rF T
t * 40 C4 / C07s4 K00 p0 E0 4 1! S
@ T
& p 4 B P4 4 4 Pa * (K 忲
0- @L0 ,0$ R @@0 0訷
0-L @L 嬲H0 0 S
S 0 S @ @ 0訷
0-L P< 呲80 @ T
0 S
3/ @ K0hŲ
-PL `T pwH0 @ T
0 S
3/ PP @ 婲 訷
Q - L
S
' S C P - /
-@@PL0 S
L ` ) 0 0 ` 0 0 S
0 0 Q
\ R
x x cp ! C0 \ S0 S
0 0 Q cp]^^1^M^
0- PL@@0 S
0 @L 0 0 P0 0 S ( ! / /
-x1( 40,@$@a@ @ 2 0 0@0@ @@@ \T0 H @ 88 r (Ko ^<W^^^x]u@ 'D 5u! 0!0,p00! R 0!(0(0(`(P
-LM$0 @ `P VD
$pK0',K 0 `P9
, F P 3 4VPVVVV,0( (0 , ' , !a W V ! 0! ( ,0( ,0( (0 , (`x,! R 0!(0(0 (`,! 0! K
-L$M`! P R@ R R `p ` 0
P 0 X V `p V 0| &0 D0 R
R
Rr ? P8 n 8 P
P
Pe 0 r 0
$ P @T
D @0 P R @0a$0! ` (`,`0 R
Rt
RP$ 8K 5 `Po
0 #P @ ;
0@ 6
R* R ʔP ڮ Y
А Y
,$ Q
(0 @
0 Z 3 0 X P 0
P U 0 0 P 0(`4000D 8000 @4000:t(0 P S
48 Q8 0 804 0(0 U
z @0,pK0K `0' 0 PP Y P40 @00(0r 0 PE(` Uk 0V\VVxVV0 S 0 S > 00 0 R HT a! W V 40 @0! 0(! 8 KF0 @ 0 S 0 S 00, P
48 Q8 0 804 (@4008000 4 0 40 Y0 @00( ( 0 ( 0 40 (`(@! R 0!(040 Y40 @000 (0! 0! P @" P ! P a!a` p ` Y X ` p
a`Xp` p`P@P P x D T
8 P
P(K谷
0- @X0ML0L0 0D0 0@0@@@ X$P q K0 V$V^
0- LGH0 @ Y P P 0 G 000 0x
-L M80 3` p刡 0
@;
01<0 T
h3 0 T 0 T/ 008 P 0 P%
@
P E4 U <0x`
m<0 k?0 0 0 ,_ / 0 // 0 -/ 0 ,4 00 0{ L0 ! 0 `0 P / / d 4 @ P U L0
`0(
P / @. 4 P 0K 0 i= PP ur 0
7SPm
P U80 P Pg R
0 b 00 00 b 00 0P 0 0 S09000 T#
0
X@ 0 3 0 p
3 W
0 . : T
E@ 0 . 0K p 9 W T 00t R
8 0$ p Y
pP
0 . T
d 3 0 t0 S h. @ p@ , 3 0 3 P (K ^
X0 - PL
P
P
0 P
$ (^ @ P 踷^ D0 R
P *20 R/ R20 /
0- @$0 L X K0hFx
0- @L F @ 0
0-L P @P
0+ Mt P 0# 0
-L @` PP
0+ Lt @P P
Q0-L@ K0h P 00 s
0- L @ R (0 VX 0 000x
0-@L P@D T@ 0 pX@0x
-LM0 0 `0 0 0 00)
0 % RdP h a
h `@ T - @@@00 S+
0 (
0 00000000 0 00 0 000 p0 j P
0 $0 R
0 0 |- 0 P_ `? 1018p @ T
0
? @0 0 0 P
0 / R
P U0P 0 !"P0P @ N0@- 0 S!
d> ㈁ P
0 S
0 01 @1@ (> 0 S
0 0 S
t0 S
, @ < 2 p0hP p 00 00p0 0 S 00p00< 00 0p0 0 / R;p 0 0 00C 00 P @e T/ Tp@ @ ^j n / P@
/ P
a a R )) Q)) ) R . P . Q*
* hd0Kh K 6 @P
h P
, 000000 d0 S0 o
t0 SB 0 ;0 S>
0 SH
x0 0 S * R 00ȗ x0 a"x0 Z"`;
Wx0 0 0= x00 0/ S
0d h0 :, 0d0 p0 0 0 Sh0d0 0h0 p0p 090) S
p00
h P
., d ,, 0000@00p00 0p h 00 S , P
, d0h0 0d0 md0 SV
S h P
S + + 0h0 d + d , 4d 1 p0 0 S
h P
d `` Q
+ d + 000d0 000p0 0 S;
: S@>L [ R
0C S h P
d0 P
+ + 0h0 d + 0000 @00!p00 d V= p00
h P
d0 P + + 0h0 h0 @0d006 @ 00 0 00b 00 SU h0 S0 T
0x0 0x0 8Qx0$0 S$ B 0`0(0(
0 r: 0P0
h P
p+ d n+ 0@00 T0 S.
0 ) @ 000Z+ @@0?@008G U ` ` K ;L KL K\0 8 <0 H v)0LK ^< 0P0
U0 00 00 (K
-LM(0 0 0 $ 0 0 0 $ Kh K
-(0LM 0 0 0 0 0 0 $ 000 $ KQ K
p-L$M0 @ P P? \ / PP V ` (000 0P4P,P (P 4@ $P ,0 ,0 ( < 4 P
P @0`$0 P p @0 V
0P " A1 ȷ
-L ` p0 @ T
C PP
h@ P d0t 0d0 `P
0(0 ( /0N 0PX0$ k ` P ط 0 Zȷ 0 Zȷ0 Zȷ
0-LMt0 P S S @P p0Kt ! }S P S P @ @C% K0
0-LM P` 0 S P. t0 S
S) p0A v& pP"
' 0 Q P
0K P
,@% p0K& P @ @ P T V 0 0 P K @ 0 S # /
-L ` z= 000 @
0 0D P K @P4
K P '
X * Pg l P # K K^ @P K^ @P
S x P } PgG P $KI
0- L @ 0 00 0000p0`0P0@0x0|00
-LM@ ` Kp0$ @0 K 0 cK KШt
-LM@ ` Kp0$ @0 K 0 cKx KШt P 0 /ԟ]p^
0-@ PL
0 1K |0 S
*K K0h. 0$W^]
-`MLPP @ P2 0P . p& )lP U
0| K300 Z0 S00 S
Rr P
Pd I V P, T0 S
\_lP 8 U
K䬃^^
- pL MP `] W
I @
0 ` ^A 0 (Ko]
0-L PD Ù@0 @ T
Ph@d00d0 0ط
80 P0-L @P%
p r0 x00080 0)%*&(%)& ` \+ XKN + R0|00
- L,MPp@ <0 Xd
0 W!018`1 08 SK
ȡ E?, K00" 0 3 p D @0 0D 0@00< 0 0 ` V
E F 08 D 1D P `1`! @0 * E@0 V
/f40K 8 V
? P` V4
t0 St0 S@' S!
W!
W
0 S Y l ,0 R 0p ~ P
d0K(0 K0 `0( ' 0 @X0 3/+ @ @ V U
( W@ ( 0 X03/ @ @ @d0K( ?( V
@0K( 3( $K8
-LM 1 @1 P ,K0q P; 00 0 0 10 UK @P* @0K(` T
( T K<00 80K 1 P[0K[P h' @P k K
-LM1a @1p 0A Z P
0 +\ @PS K v @PN nP1 0 S
<0 | S P @: 00 00 0 1 11 WUC K f @P) 0 SC?K(@
' 0 P = J 9 @ K00 80C K 1 P0; ;0 0K$' @P " / @ (Kx$N| _
-LLM\5 @p P K ` PPJ A8
P0`P `00X0 / W 0 LK U\ LK >\ P
T 4 Q
L K L Kb
Pf0L KL0KP 0PX0 L K4L KH 0PX0 Pp 0`0 0 S X
0 S X00o S &(p000H
Sp%P# # * 2. p V PP p:
0 S
5 P` `@0 p0\V PP L0
PP n` œ(0 M85 (0 0 P(0 M8(0 # U 0 S W P 0
P0L
`@(0\0 20 S
\0 ,0 -P
0V PP 8 PP|
ၓ( M8M( 0& (
,0 00,0 2 , 00 (00(0 0 ~ P W P
pb
P U_ ,0
(00(0( M8(0,0A ,; S S
ၓ
U1 \0d V+
P0 P#
D(04 V P0 P
C(00(0
00 0X PK
P P`0 S
X P P
0 S
A- \0 (Kğ]]s^ } _ _
-LM 0 0 000 0
K
-LTMp hK P8 080 h0< d `0 S4 d Kb @P
h ]( P`h Y`P +& @ @0 :U @P
o (0 L0 e ` Y @ K
-LM p KR @P
^P ᅒ(` @0(0" @ (0@0(0 Ṓ V K
-L
-L\Mx3@t K P t0`P 0
S 6W6W 7WD7W7W7W8W(8WP8W8W8W8W 9W9W, d K` dK @P, p d K` d K @P d KV @ p$ d K` d K @P$ p( d K` pK T @P d KpK @P( pK`T @Px ( dK T @Pr d KpK dKT @Pg dK @ d K`e dK 9 @ dKT @PT dK
@ dK T @PI dK # 0 00 0 @ dK T @P5 p KdK @P/ p KU `@ dK T @P# dK
@P@ up @=+ ` mT @P @ > \@t L Kğ]x
-L M@ ,K LT P ,K K
-L$MP0! S p88!
@P[ 0 S d!8 & @ TN
P =?,@K00$ 0 3 ` 8 <0 嗽<00< 0 0 @8 T
=) 00 80 P
80崐 P 00/ S
S d + 0 S@
+8 q =(0o8 0 (K x'^
p-LM@T0 P` K P 0 00 ` p @ Kpğ]
- `PLH + 0 @ `P T ` +
p-PLM K `@|^ P
04 0 0!0` 8 @ %^ Kp
- `PLH * 0 @ `P |T ` *
-L$M80 01 Pp@<0 * ` @
p0 K:0@0 0 o P
U T * 0 080 P0
3/ 0P, @ P
P@ Y <080 P
0 0 80` 0P U @ 0
3/ 0P
U T0 0 0 p 0 @0 80 r*80 (K '^
-LM 0 00 0 K l@
-L M 0 p0K ] PC 00@ t0 S " P
+ ? P U% 4K P W U 4@p` V S# 8P /0 S
\ P @ |
P @] (K
- @LP0qQ ` P
s P 4 P j P V10 Q8 R 0$KkC
-LM 0 0 p0 0 `R P (K E] P (0hP g t0 S@ " @ @ " T V 8 \ K
p-LLMP` K`: P" T000 `04 \ X0 P, \ K @P
` H0` 0 t0 S@ "
@P
" Kp
p-L M 0 K 0A `P
8@ P v 0 0ϻ Kp
p-LM 00a0 0 P@ Q P
0 K @P 8 ; Kp
-5LTMP `p F
0pKt K8@u^ P? !0D 0 l h @P0@0 Op0 Y< 0 ,2l Kl @P
p t 9^0 S
, P 0 pK_ @Pp0 0
t
X,B Pp0 t @P " p t x] (K
-p 0LM `P K$0 a P d u
$K S\ @P$0
0 00 00$0 @ S
[ K
-p0LM @`
# PP
( 0 f @ K
-LM0K00@ 0 c P0 0K
-LM0K0 0@ 0 P0 0K
-LMP @ R @ ` @
0B T`p 0
0 000 K 00 S 03 P S 0 K
- L M,`K& ` P p 0@@ T @3 @(0 P 00 0 pP P
2( (K
00- 0L P@ 0P
000 S
K0h~F 0- 0
0AS-L ` ( p P PP @@ T @3 V p
T V '`P ' b
p- 0\ML0 0P !P P< hK \ P7 T000 h04 \ X0 SN, \ K$ @P
h ' H`h lK l @ J T `K CP @P l0 K 00 S 03H0 PQ @P d `0 S@3 :l FQ @l Kp
-LMP 0@!b !00 0 0 O Pe UP ^
\ K K\ PZ K
pa @PG K E @ T? t0 S:
@ @P6 @P. Ke 0K*K @P
0 0X X < P0 @P b 0 [ -@ Q\ P
(K
-LM x K
p-LMP 00 0@` IO P $ K P K$ @$ p T 9 @ { Kp
-LM@ 0K P KPK
-LM` 00 0 P@p O P $ K P K$ @$ 8 T
0 0 0` @ > K
p-@ ML `P & 0 P 0 0 `P $ =P ` & Kp
-LM` 00q0 0@ N P B/K @P & PP 00 1A ܐ 1 LA K @Pu X0 * Ko8010:j#: V0 $K
V0 0
V0
V )0
V0
0 0 0 0$K 0Đ R S K p ` Q P ) R) S
) S
S3 A/KA K0K( D A?K(` @P
A/KA K0K( H @P
@ @A?K( X q
~
X
k
@ $K
- 0ML 0 cH K
- 0ML 0 ! ; K 0 -00 c3 cr p
p-LLM`0 1 1 d0K P> `K 1 @P% 0P00 `0\@ 4P X0 'L\K, 6 @P H0 S@ dt0 S
D `0` R@ \0K( @D D
` d
@\0K(D D D H0 P
H PKpğ]̟]
-;ML 00 0c0 K
-LM 0;0 0 0 K 0 c< 0c 6 0 3
p-LLM0`K P5 `04` \ 00 `0X0 K, \ K @P% H0 S 00 \0K(D D H0 P H P
` l \0K(P D @P
D D ` [ Kp 0 c _ 0 \0 c W
-LM P CX pP 7
(0 S0 `t0 S,
0 S
S
S @ @
K j P
@*K@P @ P0@@ W
(K
-L M `p W PP"
0 W (0 S t0 S
!"K l @P ,0K 0 U @ W K
0-LM0KA@c
VK0
-L M `p W PP"
0 W (0 S t0 S
!"K - @P ,0K 0 V @ uW K
0-LM0KA@c VK0
-pLLM0 @P B hK T`` P: h08` < `0 d J4 L ` {I I|I IdK 4` @P
h S h PO W @ P P P r @P
@ n K K
- 0ML 0 c K
-LM 0 0 K
0-LHMP XK@C P X0@(@ P0 , T :JTK$ I @P @ @@ 6 X K0
-LM0 c K
0-LM@K @ P@0c P ,MK0
0-LM@K @ P 0c P MK0
0-LM 0PK P @0 0@ P MK0
p-LLMP`K ` P T000 `04 \ X0 I, \ K @P H @H
` Kp
-LM 0 0 c+ K
-LM 0 0 K
0-LM@@0 P K P 5 @
K0ğ]
p-L MP @ K V P 0 ` @ & +V Kp
0-LM@@0 P K R P @ k
K0̟]
0-LM@0 P D0D0 0K P @ @
K0̟]ğ]
- 0ML 0 c K
0-LMP @K 'V P 0 @ U K0
-LM 0 0 K
0-LM@@0 P K P @ K0̟]
0-LM@0 P L0L0 0K P 0 @ K0̟]ğ]
- 0ML00 0 c K
0-LM@H0 P K P 0 0 0 @ K0ğ]
0-LMP @K U P 0 r @ VU K0
-LM00 0 0 K
0-LMP @K U P
0 00 N @ 2U K0
0-LM@D0 P K Y P 0 6 @ b K0̟]
0-LM@H0 P K @ P 0 0 0 @ H K0̟]
-LM@ S11 \ Pp `@K K 0 S
4J P
] K 0s 0s K 0s 0 S p 0K Pp9 $ "K P `
K%K Q P `T0 V `` P0` ` Kx0 sK 0 s
|K VK \K Y,0"K0 ,0 @ z W
$Kğ]̟]
0-LMP @K T 0P 0 0 c e @ _T K0
-LM 0 0@0
Q K
-LM0 cC K
-LHM @ P P`p
0 S
<KI P < K40 ! R %K? T0 $0 ! R!$K? D0 \ K0 0 K
- ML 0 0 @0 K
0-LMP @K ?T 0P 0 @ S K0
- 0ML0 K
p-LM R 0 `P # 0 K P x 5
t0 S@
` @P "
@P K K)K ". @ Kpğ]
p-LM R 0` $ K S P 0 @
Ph t0 S@
* @P Ka )K0K @ s xS Kp
p-L M` K S P 0LP 0 0 @ R WS Kp
-L M`0K S P. 0 0 @&
00 "
0
A @ 0
@ P T 0 pH @00
@ @ S (K
p-L MP K WS P 0 S `H r 0 0 @ R Kp
- 0MLc 0 00 n K
- 0ML0 0 c K
0 -LM c 0 U K
-LM c 0 I K c % # c 0+ c
-LMP `$K pR @P $ 0 `
0K` 0 @0@ @0 ` 0 S
0 0 0 R K$N
-p`01L8@ P O1 0 0:1᧱
p- P`LMp K @ V T D0 S 0 "H @P Kp
-L M0< @ K q P @ | Kğ]
-LM`Ё 0P J 1 R0 R 0 0 0 0K
aR P 00 `
@L ~ t0 S`
0 `
Q ` (K
-LM@a0% J 1 R0 R0 (K /R P (0 @
P M t0 S@
`0 @ Q $K P
0 S
0 ,00 0 /
0- @L\ :P00C S0
< K0hs, 0$ , m o K0hS
- @ PL T
P
`P P@
0- P@Lp 0 S
\ fI00H@ 80 S
U R 00 QI P Q 0 / S Q /
-hQ `L( @! P
0 SO
TE
( ! @ TB
0 S2
@@ T
0 S0( 10! ( !p T @ ⫃ ! 0100@ S 0 p0 C 0݃( _! ( j!@ 咃04 S` @ ̃ 元@ 4
-L `p( P1
@ T
` PP&
0 S0 0! [8` s P
0p 0 l8 i8 X
H Q b P , H0p 0 冃
00-$@0L 7 H K0hs
0-h@Ld( , , yH$ vH7 0 00 0 \ 0 @
0c 0
-H2@"0LM S @`
2, \1r20,0
( 0L0 (P0D0,0 P m
P\ UP,
U(P K_0 Z0 40 040 0K Ȁ j P O PPk 0 P 0 Z0P2 lt0 S0
0t0 S.
P$ K# 0K*K P ] P
vX0 0X0v
- O y(K
-PLP @`
vX0 0CX0v A P Z
-L,M` pကP@ P \T0KL0 0H0 $K 0T P@ S<@ 8p L Kk 001D040 LK N @P W0 LK a w <0 Y @ 0 00 P 0 S@ X (K
-LK0 0G/Kp 0$0 @$ 0 0 0- T V 0 Kȟ]
-LFMP p` 0 G K 9 @P 0I/K u @P GK0 0>K0 0G/Kp 0$0 @$u 0 0 0- T V 0 KП]
-LFMP p` 0 G K 9 @P I K Y? @P $1GK@t0 0>K0 0G/K 0p0k @ > 0 0 0- T V 0 K
p-LGM@ P` 0 G K 9 P \0.K P GKD` 0 00G/K @ - T V Kpȟ]
p-LGM@ P` 0 G K g9 P \0.K P GK ` 0 00G/K i @ - T V KpП]
-LFMP `p 0 G K ?9 P K > P 1GK@ 0 0G/K0 A @ >- T V K
-L$M@0 p 0 K P) ` ,0K00 0 @P U,0 P V,0 `c(0K00 0~ P
P @ ( ( ,00 00 - T V Kȟ]
-L$M@0 p 0 K i P) ` ,0K00 0 U @P U,0 P V,0 `c(0K00 0C P
P @ ( ( ,00 00 S- T V KП]
-L$Mp 8K C> P+ ` 80 40K00 @P U40 P V40 `c00K0 0 P
P @ 0 0 400 0 =- T V (K
0-LBM@ P 0 E K i8 P P0F/K P EK 0 E/K @- T V K0ȟ]
0-LBM@ P 0 E K E8 P P0F/K P EK0 E/K @- T V K0П]
p-LCMP ` 0 G K !8 P K = P 1GK@0 G/K m @ e=- T V Kp
-`L0L @#20 00F SP ` V P
V `0 P
`0 0
-T0L M% K 0 0$K @ P d0 K03/ @$ K訡]
-H0L M$0 0) K(K @ P d0$ K03/Kġ]
-LH$M 0 - K 0,K @( $ P d0( K 03/K]
-LH$M 0 - K 0,K @( $ P d0( K03/K]
-H0L M$0 0) K(K @ l P d0$ K03/K]
-H0L M$0 0) K(K @ U P d0$ K03/K4]
-H0L M$0 0) K(K @ > P d0$ K 03/KP]
-H0L M$0 0) K(K @ ' P d0$ K 03/Kl]
-H0L M$0 0) K(K @ P d0$ K$03/K舢]
-LH$M 0 - K 0,K @( $ P d0( K(03/K褢]
-LH$M 0 - K 0,K @( $ P d0( K,03/K]
-LL$M, "K 0K!K 01 K @( P d0, K003/Kܢ]
-LL$M, "K 0K!K 01 K @( P d0, K403/K]
-L$M 0 0D$ 0 1 K 00K @, ( P d0, K803/K]
-L$M 0 0D$ 0 1 K 00K @, ( | P d0, K<03/K0]
-T0L M% K 0 0$K @ f P d0 K@03/ @$ _ KL]
-T0L M% K 0 0$K @ L P d0 KD03/ @$ E Kh]
-D0L M% K 0 0$K @ 2 P d0 KH03/K脣]
-X0L M$0 0) K(K @ P d0$ KL03/ @( K蠣]
-X0L,M40 , ( 8K "K !K 09 K @0 P d04 KP03/K輣]
-L,M\"K "K 04 9 K 0 8K0 @0 P d04 KT03/ @8 Kأ]
-H0L M$0 0) K(K @ P d0$ KX03/K]
-H0L M$0 0) K(K @ P d0$ K\03/K]
-L,M 0 0\( 0 0$ 4K0 5 K0 @0 , P d00 K`03/ @4 K,]
-LH$M 0 - K 0,K @( $ x P d0( Kd03/KH]
-H0L M$0 0) K(K @ a P d0$ Kh03/Kd]
-L$M 0 0D$ 0 1 K 00K @, ( G P d0, Kl03/K耤]
-L,M 0 0L( 0 0$ 4K0 5 K 0 @0 , + P d00 Kp03/K蜤]
-H0L M$0 0) K(K @ P d0$ Kt03/K踤]
-T0L M% K 0 0$K @ P d0 Kx03/ @$ KԤ]
-D0L M% K 0 0$K @ P d0 K|03/K]
-@0LM! K 0 K 0 @ P d0 K03/K ]
0-p0L M% K 0 00$K P P d0 K03/ P 0 0 S @ $ K0(]
-P0LM! K 0 K 0 @ P d0 K03/ @ KD]
-L,M"K0\9 K$0 04 8K 0 0 @ 0 00 y P d04 K03/ @8 r K`]
-T0L M% K 0 0$K @ _ P d0 K03/ @$ X K|]
-P0LM! K 0 K0 @ F P d0 K03/ @ ? K蘥]
-@0LM! K 0 K 0 @ - P d0 K03/K败]
-H0L M$0 0) K(K @ P d0$ K03/KХ]
-L$M 0 0D$ 0 1 K 00K @, ( P d0, K03/K]
-H0L M$0 0) K(K @ P d0$ K03/K]
-L4M#K0dA K,0 0< @K(0 0 @$0 08 0 0 0 00 0 P d0< K03/K$]
-L,ML"K "K 04 9 K 0 8K 0 @0 P d04 K03/K@]
-H0L M$0 0) K(K @ P d0$ K03/K\]
-L,M 0 0L( 0 0$ 4K0 5 K 0 @0 , v P d00 K03/Kx]
-L,M 0 0L( 0 0$ 4K0 5 K 0 @0 , Z P d00 K03/K蔦]
-D0L M% K 0 0$K @ D P d0 K03/K谦]
-LH$M 0 - K 0,K @( $ , P d0( K03/K̦]
-L$M 0 0D$ 0 1 K 00K @, ( P d0, K03/K]
-L _
- P@`xP 0L t0@0 0d0L00L0 0 ( 0 P 0 P耹 0 / /0L0 / / / /0 /
-L
-L {
0- @L d b P
0 P
h P
U 0
0-@0L$ @ U 0
-Ld (_
-0L j
-$0L@ 0 j / / / 0 / /0@-0 S 0 S@@0 S 000C S WWWWWWWWWW 0( 0, 0 / /
0- @ PL *j 0 U
K0h0 bj
-0L `p0 @0 R
R \ \PH P PH 0 P@0 0 0X0 2( ㈁ 0 @0 ,K W PP ,0(K 0,0 00K PP ( D,( 娝 PP
( M( , ( q ( P$P1 01, 101- -p@ ( 0,0 0
0 S ( 101-0
$0 S$ , 1 01-0 0 ,0! Q*! $ R4 S(
0 S
( 1 0 S( P {(0 - P( U ( $0 S a(0 - P( , U( K@_G_
0-0L @x0 S ( 0 p0$ 0N_Y_]
0- P @L T
!0B s 3@ 03@ g d K0hg
0-| L @000H0 0 iH0+ R;H00
0-0L @ 0
g g K0h;
-LTM&K @ 0h0 0 S|0V 0 < K $ P1/cKKt0婗) S 0`0l0 L0 0 40 L l0 V 0p ` R`0 S HgT0 0T0g ޥ0H $` 00` 0000h0 S 0H0PPP 00H 02!20 R 0H P 0&K%K/ 0 00D0 L eK`Pp 0 ZK
%K \0p#K S R& 0 S
0d bT0 o P\0K
g K ZB
KL " D0K040K0@0K 0 0 i P
P0 &KK Q P0 0\ Z 00 SH`
gTd ` b\0 H v 0 ) L 2 ԅK Xl #K 0#@ V
H 呦h0 S.
H @ `a崠P V㰀 ʀ 0! `! 0 !H 03/ 0!!`a0 !h h (Kl hsss
-LM 0 00 $P@0
0 0 0 0P0 90 00 00 0 @ f 'K ?K R(K | \ K 1/K06 %K P0
@ if܅Kt0 S 0 `0T00 à'K X0 0 &C6 0 )K V0iKK0 `l0 p0 'K 0)K0L-6 0 0 p
m0 P 0 K R vz1 S0 " P5
0 S
0 S
e#K R0 0 S N
L0K Y
#(K 'K 0 `|0 0 d K (K1/ h |0 0 \ K (Kn@ e t0 S `0(0o`0 (03 R Sd|0 0 0 S_
3/\0 Q ,0KD # 0 'K P0
PP p p0 P 10C s 01 S0 00 0 00 R 0 S
! L K LKn`0 0 V Be ` e V 0 S
`0 9 S
0 *8 03/ P{ 00 0 S
L0 SI F0 K?o20 'K R0":0 10 0 000p0K 0'K0 S<0 p 0
0 S ~ T !#@ P 0 S
0 S f p0 0 S
0 S \ p0 R 0p0 'K K S R0 0 pp Rpp W
, p ,0K ( # )KGp0 P
0 S ( p d00 dfKp0 0 t0 S 0`00 0 40 0 812 1 0 S 0P0 `0
0 60 )K V0p R 0` ` 0 p R`0 00$``00000` S60 0L7 000@7 00 00Pf U
&61z3'zzg@
0 `Pg)K'KP P P 0 S
'K K R0"VZ13@ K 000 0 P
S:# 0RK0 ` KK l0K0T0K0h0KK 0 0 `P0 00 l0K q 0 p`'K P0 V0 0 K p `h/K'K 0 0L P00 P
pe'K Q0?K P/K !#@
0 %K S R7 'K 0 0$p` K V0"&z0 b|0 0 00 c0 e R
R# # R0# # c00 . )KK S R0 0 R 00 S㰀
| 0 a 0 )K gK `Vp ᑯ %K 0h 'K 0'K00a0 ` .0 Sz
0 S
ᝠ ` 0 V 00 S!
0 S`
|0 1 0 00? )K1/ `P c0 R !0 R Qc ɡ0w Pc0 `Ipp0 U* X%
3/o"##
@03 J0 U 0 U0 S
3
ἥ3@
3
3C03PHc0 S
& c P
0! 0 S ` E
0 V 00 S b V
p b` L0K Y
0 00 0 S
0 S
0 8 03/ S
0 Sh
(K = _ O
-L]MO K 0 P0t1 ; 101 ;0!0 R41 ;0l1 |0X1 04! S0 0p1 0H1 0K0`1 |0K01 p W H0
;H0l0 S , Z
H1 S
8 03/
\
Z% 0 "
014! S `
I pP
sb pb`@ <`0 T
@
@ P
0
H bT` 0oob
0
1H* 0 K?K O?K PA& 6:!#/1$1 ! I?KK K R00 0x1 H09 p + d!
S 00a\1K K SI?K R0 P1 S@
PA\1P1 = T
30 a
`G?K * 0G K s
0 p S @ 014! S
I?K K?K P0 0K@ 0`10 \
a # 0 # $ `I?KK K R0 @0 T0 00 @d1 S
L1 ,
X1h!0 R 3 S H0L1 p0 A 1 q \q {C?KI?K K?K P0 \@O?K P0࠳ ࠣ P0 R, 1 S
# R -# |1 S
G#
p1 #014! S + 0 P1 b014! S03,#101p: R0
0 S0 `!`1 00 K 0 q`|0!C K 0 p07/ p #`I?KK K R0 @0 T0 00 @I?KK K W } R00T1 ]!10b6G/K 0 R0NG?K @HI?KK K R0 ph0d S d 0T1 S
H0
t0 S `0(0 |0 0 0 S
3/L1
X1h!0 R H0
;H0l0 S `t1 00 S
H@ I_ @@6
_PT0 S
,@T0 S
% Z
H1 S
8 03/
0 R00T1 8H H 03/ pP 0H1 c (Kl _4 _
- 0ML 000! K
-L M@ 0 Pb ,0F 00 0 0 K耷O
-L M@ 0 Pb x,0F 00 0 0 K耷O
-LTM 0$@P0p p@`K
S0 0 00 0A T@ @ T pp Wu
_r 0K6 # P0 >_@e @a
1 1TK2h0 ,0K, #&K` +_ X X0 V# 13@
& 0 @T0 :H K KL KP0 8@ <0 L h0LK @P < R
T 8 ` @X j ^ ^ `X V
T
3@ 03 >F m` T
V T pp( ^ W
^ (K
-L,MP0 1 0 b@VT0K T L KL0 H@ 8@ PP dK 00 U2
V2
4 P 0 P
40t Rp0 S 40 P
0 t0 S p0 S
P 4 0 0 $0 40 P
4 P
@ @ @0 P
C @
@4 P
9 (K
-LM `@ 0 W T
W
0 00 0 404 0X0000< 840 00(0 S
3/ HL
^WEV
-LjM d$ @ V B V *H$ V
B 8$ V4$ ,$ V : V $ V
# V B V* *# V'
# V#
# V# # V
# V# # V B V *# Vp#
# V
# R H# V
l p 2 Ve
2 Vv
3 V~
2 Vj
2 V]
2 V 0C V *2 V
20 S 20 S f/ oKr E/oK oK|P I070 0 x pP& 2H" V V! )*8*0 "6 0 p$ b& `p0 `6 ,:0 & 00 p0 70I R 0 P55
0 P
80A 80A : o_K 8 S5 E/ f . P I P@
{ @ I 0 $0 0 S 0 oKR P ` vIP U
1 0I U
$Kgdwd~d({dЀfdydrdAd@edAd@rdAmdedAhd |dg~}d(@~gd
-LM @`Pl - z&**0"6 p 0$a& `p0 `6 ,:`0 & 0 0 `P
0P 0$ {{ 0<
Ki03
b <0 V `0 p ` 00 P 00 S
V0t 0 0 P0 0a 8 `p8 V K _^_ _3_
-LM @*ZZ0
%6l Y|`0␀ Q0 pH00 S U0= X0 S
0
$ Q
0p
0 01/ 0P
) 50
0 B U 0
WUT0PTP
WP0PPP 0 0 U
8 U0 S
T P00X0 0 00 H00 (K
-LDM pQP ;
@@0<@ 80 d@ ` ! 4 d K P- P`t X@! p0 ᾭ @P " @P " @P
0 2H X00X0 0 nH " K / : :#0 P05 7 # /ᄹ
- @bL -"0 \003/b
-LM` @P
0 S 0h Z
PP P d P0 P P 0
Y
0`(Ko3
-L PP
0 S Uo G ` GP P @ 0! Q P @A ` G G Q^
-L M`p @P >
0 S : U_ G 帐` G ؽ P
ӽ P`" ; +Ġ Q P 0xx a
r*"K- #K"K 0K8/ ` ` ` G G $KQ^t_]~_
-LM@P7 `PpB
0 SA 0h0 S=
p0 0 ; p6 0 T
0 0 T
0 T * 0 W h 0200 Ki@ n y @ @0 y **+ * yy K}d(@td@zd@vd
-go PL G렑者pE @P_
0 S
p;1 C S! 1
01 *G00$0 0密B !G0 h x @ F T 0] ᜨ3 p pP G Ⴥ' G0000000 0H0H0$#0h0p0!"$0Pp$0 0p 0 FT0 0T0F I F $KkF|fX
-L @n PP0
0 S 0h R 00' $ R$
jP 0 : P # go gF1 01 p F $KkQ $00$Kk!J
-PP `L+ @0 S00go0 @F1 C S! 1
01 0 $ &c nF Kh
p-L M` KPᓫ P! @P
@P
0 F 0X X AF o 0 0Kp
-LMp @P /
0 S + Uo E ` E01 S 0d0 S
0K PP 0 h d00d0 P
W,1(100,1(1,!(1001 ` F F K
00-@L J P K0h 0T]
- RLM `@
R2 4K 4K[ p P(
4 KX 0
` 0 B ^## \
1 p0X`ß% v #zf 0 ( 00 $K
p-LM @P`? P
0 S 0` 0 0 FKpx_XteX
p-LM @`$ P
0 S (0` 06 00 FKpx_XteX
- @L@ ` yqPp 0 T *0Q U @ ]Y P0 S P0 q,0 0 U S
$Kk۴ 茹
- QLM `p0K␐lP Dt@ T
W
01 S
@ 'E$K Ew ! K?w E K
0-0 Pd@L T@Dd@Oo B` EUE T
0 h 0h 0
-L` @P
0 S U_ D ` D
V,1(100,1(1,!(10 S01 Kh ` D D
- PUoL pD0A T D D ` rD Kh
- P@aL M p p 0 0` U
A T
Q `P00 P`p V [ 'Ipf hu ]go 3 9D~1 S
101 oD0
ὧ0 ḧ a 0 耄l D p00Cp00 S 0 l GDp_ D Np008 0<00p C Q : (K脹 ]@]_
0-LdM P0 ( P `
4K * P0 * R 0 U n:#K @-ᜐ堀***+ 0 <0 剻 0 ⛐p0 ]o⁻ אⅾ S g? P0 C> T0 l0 80 CH00t 2 Q
*$K+%K*$K+dK&K R 0`p 0fKdK R0$K V 00 S %K R 0`p 0fK VdK R0 \ $KdK S R %KfK S R < 唹 P8 C Y6 X3 0L 000o8s
` V
P Z` < L0 D p PD L0
`b o Y
8 Cp08 0Cp00 S 0 VCT sP Cpj :h P # Hh Ro 0 o8 Bp08 0Cp00 S 0 .CT KP BpB 9 i %` Bu P .0 J + /P p @Xa 5: 1 i )0 0*kp@ ^@ @`<0 X ' Np0 P 0p0 t0 0t@0B Z `c9 0 Z
!D P D0< Z0 `<
s99 @P(K豾^xfX_| _ ]_ 9 h
-LM 0P 1 0G K p1 1 00!CKlD 0 1 KBt@0K␐ T+
1 S* 0 S# ` Kt K 0e0K0 t *%K+$K0K t E/K K `P 00 0@` `p0 0VB $K
- @L \nP|p 0 T *0a V
? P U P
: 7 0 @ n 茹0_
-t@L ` /n @ T *Q U
0 P ( n @ @ xn 脹
0-L Ln @@P 0 T *0 Q
@ K0h\nꌹb_
-L A Q m m 9 P PP
7 mPP`0 U" * Q
R 0 0 0 S h 0 0 P ( Khnꄹ| l__!_!__
0-LM41 @L0 SG
$Q m K P 8 K K̦ P 1 $ P
' P
R
P U
0 3/ P o P
8 Pp( mK0| __ B_q__
-LM#Kp0 PV` ` p@d@ T
h0@d@00 @ 00K A Y ' 0 t& 0 b0 $0 0#K#0 p
%~ `
| @ Td00Cd0 0 @ (K
- PL M `pl븐 0 X% *0A T
0
000 00 ն P * S R + S R U P
0 0 $ _ *m (K茹_
-L @P P `D @00#4 V P > P
0 ]@] `8 8#4`# /
-LM P` 79 0 @ 0 @ P4 0 4$#4 8##<00 4$#48#x#<00p 4 8 40 80 0 $ 4"40#4 0
0
$4"4
0#4 0 0 4 8 4
0 8 00 4 $#48#(< R=0#<0ĕ ĕ0ąą0 8#Y! ! 0 4 8 4 0 8 0 0 4 40#4 00 4 40#402 Q W0!<30C(,00"0C!0C R0C X 0KⰐ$ 0 P 4"$4(!4"(0 ? < 9 P 6P T 3T X 0X \ -\ ` *` d 'd h $h l !l p p t 1t Re 0
l P
l PN 1 0EK1 & C?K0C $ $ C?K $ $ B?K0C $ $ 1 Q [ Q0 q 0K q 0 %K 0 %K0K0 1 q K5 P 1 ` ypg P
08 n 5
(KRE MP __p]Q^ _L _
-LyMPp Pw 50 @P " ? `P x P 0S W :`r Z _ K8 <_/K& K KT 00 S1 !D P0X S1 4 ,L`/ /H0/ ! 1 51 G ! m51P @ 0 `P
$ q Z 0K0pa 1 V ` {K ߥ ሼ PD
w K ֥ &sK↥w/K&iK₥ 0
2 2
r P 27 @2
, p 0K p K" 0 R0%K3 S0K 6~8 i Kp KL P] 0Ki K m PB 0K 101 1p1! ST Y|0 S
>
Q #&-- ##?0<404<0 00080 X` 00``` 0 ϴ (0 0 0< !,0 $0@000(040 ,0 Kh,$L
^WEV
-(0L @#0 !! `P
0 S 00/ ꜀ (=00C S$0" 08 Pp$ Rv : W Pb SP1` 0 W ״ 0PeP 000 >= $Kk|,$
- J JL$F `!ѯ PP+
9@A0tp D<
VL0@L@
VH0@H@L H0 0 SP0
= =D < ` 坬 @P 3 = ,$
- J J<$FLaY(p(0Q< ዯ @P U
< q3 ` Ꭾ @P < U
` V 0 S
0 S
0t` Uu<
WL0PLP
WH0PHPL H0 0P0< < ,$
-L pǽ @t` V
0 0 0 ( H/o6" Q R
R D p P P
# P
0 S
P U
P 0 0 P
6 A P 60 0 000 6
0-(@L,0 S
S
0 E P
0 S K0h[r0
0- p`PL U
V 4 @ U@1 , Pd `0 > _
- @hPLp `N6 0 S$0C(@
S
R
(0 S$0C p` Kh{6갹G _
-p@ LMPK CoK ᠭ ` p l 0` 0 0
P p 偀0?o2 P0 S (K谹X
- pLM`KP` @ 0K\0 0` @0 0 0 000 0
0V?o2 P0 S B P (K
-LM p0 @0 0 x0 l0K | t0 pp ,@ T (K @D T
<0 S Rz
( " < 0 @ Qm
0 S
K 3/ K P `_
W K 00 p00pg ! 0
V`
`! P V`0g?0 s5 0PP Q 0 S 5, ݦ 0 ) P 0P P 60 S5Io
0 0 0 q P03/P y5 Y
p@ Ts
@Dw갹
-LCMP `
p
2 S*
0 S 0 @ (@, IK↬ 2I/K0 000 0 00$ q Q , KX
0 -LM 0 K _[
0-@L P 4 @ T
$@D T
0 S
(@ T 0 0 0D No P 00 r,
5 T j0谹 X]W _v _
-LDM @P
T- x Q 46Б 1 @@ [묡 q ,0K@# p` 0,p(`$@ @@ @ 00 SC
40p0 ,0 0! 1'.01 00(` $@0 @ 0040p0 ,0 0!0 000(`0$@ @ @ 0040p0 ,0 0!`0(`$@0T0 @ @0 0 ͂ (K谹: _K\X _X^X _
-LdM Q P
~q #g Qd 00 0 0Pp0 Z X_ VP UP HA 30 SPD
@Cl0K00t0 T>
V W R-
( K , l 4 K h K5 0 g K6 Kf K8 d < ` \ 3 R< K
t /f 4@ V 1@ #l K P
f0 Grp SP
@Cp 3 Pp (K谹 -X` P𝤀 0 !`!800 , , !hsss 0!< 0`4 0 , ! /hsss
- P `\pL @ T
0 0` 0 S 0 0 03/ rA Kh\
-L4MLCL `!(21(2 T D3 PX@ U 3 s00 @ KP0 N v3 @ P\p L0p W
Є 0 S
S
: S 2 P
S
:s S \2 P D2 82 P 2 P 2 P0e H0 0 Y Xi :
Yh .> 0e Y (0 Z
0
0 j0 j<0 7 L x P U
L嘪 0HpPP( p$ Q P @3 * 80@P S 0 U
0 A PP220:03` 0 0 6/ U
P `0 3/ @\0P@ K ( X0T!(210#(2(KKʹȹ
-L P(o2$q@ a T q @D T
b2 0 S
0 S 0 40B 2 2@ T
m8 @ T
$@D T
0 U $ 0 0( S
P
0 0F@(@ $Kkh2괹K
-L p8 `^ @P P 2 00(0$0,0d00 p 0$0 0$p S( (0 Ҏ 0 p `$Kk62 _K
-L M0
" R:0
0 R
0(0 \ $@ @ PK _[X
0p-LAM @K !$1 01 0 ` 1 0P! 0K僩 ?Kp
- P L`0@
3S H L0 S0T 0H 0b S 00 S
00C0 000 ? 0 S
( ( 0 S
0 0A Kh`;
0 -LBM0 0 0 C K>K ! 1 l K
-L @P`) (000 S
Kh/ 040/
0- @ L P
K0h{
- `L<-1@ T (k1F 1 tP101x00 150 S
050 0 S
p R1 L1000 00 P
G P
B P
= P
00 0 0奒P 1 1 E ( 费
-L,MY@p1 `01x00050 S t ⷒ P 5P1T9 W
G H9 W3
0C W
,9 W
$9 W|
9 W9 0 & 9 W
0 W
0C W+ 000+ 8 W
8 WU
8 W
8 W 8 Wb
8 W
8 W x s p8 0 `8 W
T8 W 0<0
0C W
0 W
0C W 060 8 W
8 W 0@0
7 W9
7 W8
7 W
7 W 7 W
7 W
7 W $ <00P S0Px0 P 0 /0 -0 0 S 0 S P' 0 S 0 S 0 00 P P Z0 0 S XP X X
Q L p P
D P
ˌ Pp 5P P ` pdvPP / /䀔`巌 0 0 X4
d / 0 S 0X 4 RG PP040@ / 0 S 0 09 / 0 S
0!H0 (21(2L h5 p W.
PP$pG W*
0H R 0 S
0 S P 00 @ KP0 o P{P0 @ K(p W
$pG P 4L!(210#(2 li/ g/ 0 S8
R2
80 ` V/
$`F V,
S R
(` 4P7 00,0 `0,0p0,0 S 0,p ` U
n P0P40
P P k/r %/ 0 S
P P $/ 0 0 Q
0A Q0 S
2 P 0 F0 0A0C S
R$PE UC
p W (P U< 2 P0(p S` V * P n
$ P `` b . 0 U
S
00,0 P0,0`0,0 S 0,` P . P P1 H1 0 <1 ~ P 0 S0 0 P0 0( 0, 00 !& (0 0,00! 80 0 0 0080 <0@0 . 0D0 . H H P P 7P (KkB@|B@iB fB@hB tB@oB@f@wt@{f@kB @oB@{B@~fyB|f}BlB gBzBvtfBwBlBK _ / P /
-LM K
`8 8#4`# K 0M000 4 Ѝ / po / Q 21 / /0- 00 Q : c Pa Q 0 0 P ^ 0 Q 0
Q ( 0
0 -L 00 Q : c P 0a S 0 0 P 00 0 0 00 Q : c P / 0 00 /
- QLM ` i
P@ pA0= S
I S"
% S
S
S
SR P S
SK 0@ S
Sx
SA P S
S7
S9 0@c( Sp
$ S
S
Sc
+ % S
' S
& 0 Su
, S
- S T 5 S
< S
4 S d S
! L S
E S
@ S_
D S 0@G S
H SE
T S
M S
P Sf
` S
a S
\ S @ S
| S
l S
t S 04C S4
S P S
S@
S S
SN
S 0@$x 0 Q" 0 Q& a R " *0 Q * a R
@\ @X *0 Q * a R S ( K S ( K
*0 Q : S ( K (0 @ S1
@. 0 Q
: Sz ( K (0 St Q PPQ @ 0A 0Q 0A
0Q 0僑 0 T 0 T 0 T 0
T : T
0 01@@e U2
U.
@@$E4E 0 o X @ 0@ 0C @d 0 S * 1 0 U
* 01 3/R $K
-LXMX0 L0KT0 0` \ ` K P0 { K
- @PLPp
p Wp 0E S *10S0 S a Z 10L \ XX$XXX`X0@ St
Sq
S) Sm
Sk
` Ss 0 Sp *3 d
m 0 Sj *^ P \[
\X
\U
\
0 \
@ \ \M
` \J
p \ \
\N C A 0 S> C 0 S
S
S 0 S
@ S:
Y U Y, 1 ! 0 0 U' U# 0 1 0 S
@ S
T
\
S 0 \ * Uu@ @ @ @ F /
- @L M$PK `@% (P h+쀟0p S
@ T 0& S
Q P ,,0 \( P 0X +, P
0 R0(0 0 | t+0 03/ KH
-LM p `d ` @ + 㔠0P S
s R M+ O0 0 (Ko / 00 0 @@@(Ko4+H /
0-(@L * C 000H _
-@L ` *0lP0 @ T
0L R00 0 + p7/ * Kh*H
0-(@L * 0 0d K0h*H
-LM P0p嬀OK`0c U *0cN,K` ZN&؇PN,K Z`2`7N `5,`K Y:`3 `5 \L,K \ 5@ p-K% $(K轘] _
p-AMLM0 P S`@ 0 S 0 S 08
,BK0 0 B>K Kp _ Uy^01(!(" /0!(21 ( / / Q P / / / / / / / / 0 0 0 / /H ao /
0- L @Ꮱ < 00
- `PL Mp@ KP @0K f \ V \ P
E0 S
00C S P U 6 0 S
0Ѐ 0@0K @ T
" P
@0 S
P 00C ^ R0 0f S W @0[ S
< *@ K' $ ) Z@@K(K _ `
0- @3L 08@
~ j8 (0 P U
(0 S
3/XP0
-L M8 h K *
-L M8 Q K *
-L M8 : K P*
-L M8 # K P*
-LM8 K *
-LM8 K P*
-L'7
0- @ PL P
0 S 00P00C070
0- @L( 8 ) 0
- 0 pLMPK` @0 婠 \0`K X~0P @ 0 0 000
0\` ;s?o2 P0 S (K$X
0- @L F* ( K0h)
0- @L ( 7* K0h(0/
- PLTM `
P
P0P 0< 0804P0,`(p$@ @ @ v 0!<0<8p0x04P00<,` 0(p$@ @ @0 v(KdXy^Xqo^X X!^(Xi^xX _?@^ _
_ -X` P𝤀 0 !`!800 , , !hsss / / 0!< 0`4 0 , ! /hsss
0-L P @ K0h
-L P p Y
@0 @ T
00 S
`3/adX@ Kh
-L @P(p ` r' 0 R 507P00
000 SPPP P000 ' U ( 0 (
) 0)3
-PL @ U
y2 ` S
0C8C8 S2 5/ o0 S
0$ Kh蜽
- ` P嘐LX p @ T
0 S 0000C0 J T
%( 0 P%
003/0 3/\
-L?C d 0 X^ Y|
-@L & P0 P` 0&^ L H` @ 80 P = Kh `K _K _
-L@M 0K #0, ( T L$ /u 0 0 S
K \
Y _蜁
-LM0 0 K w^
-LDM0 S$3!^ 00 @ p `(0200p,`$ 00K t P
;] 0!00K$ ,p(` t P 0!`2$ 000K ,p(` t P0 0 0!2$ 0,p(` 40K0 K t P0 0 0!1$0'> 0,p(`40K0 K t P0 0 0!x1,p(`0$ 40K0 K t PD1 0 S
W p5 0 S
( 0 $厇$ & 0 S S00% 000 P @ R
oR 0 R<"82oO @ ` ?S
`<2 S?82<2_ S<2O @ (Q 0 ,14 PHB T
D@D T
8K ' 8K P H@ ^ K
-LM3 @03 vI p `HR U
DPE U
0K ){0K ` HP 5 x" P P
0 S00P00C00 " +1 ,0 P U
,0 S
3/XP K
-LWM @. _Kə !s I" "0 S
$ P
-$($L2 S
\ Lw 0L2 HR U#
DPE U
0 YHP
' 0 p` V
*\a R
H0_K3/0,` S P P.( % U pb P U
40 S
01d Q
dq40 3/0 Y *\ 0 S
H0_K3/,XP !1"q0Q1 QP <" R8 8"< 8"b!
& 0,2 >" 0 2:" (KK _@X KK`P*蜁*rR
D3- QL @P
1 Q
3 Q&
3 Qp
3 Q
2 Q N D! ! 2 Q
g0C Q
`0 Q@1
2 Q
0 Q
2 Q 2s ! L S Ri
\` @\ @` \ 0\ `
` \
\ ` ` \ \ `(` \ \0`1 0`13 J ' 3
1 ` 1
3 ` 3: 0003 31 H0 @00 ?$8 d 8 _ h X Ju`$ S R
L0d 0 S
4 iui iivi ~iiip 蜁0L K
-0L p0 SoCP 0 SHB <2 S
oC VD@D T
0 R
H@ T & P
3
P
0 S
& P ` X
-L @`" P @P
@ 6
-0L `P U_Ep 0 S KYK` _
0-L @Y PP J, g 0
0- P
@ L 0B \ S0 @ U
R Kh+\0 `@ TODLp
T
0 S
P
00 0$K舺LG d L*
_] ݆ P*5 蜁*<
-L Mp 03K3 PA0A S`0 2@ Rt
R
R
RA
R , K
@ 0,
$ K
0$0K^0"0K0# K0!0K0 0K0 0K 00$0K 0 09/ Pc 0 @L
CK
0 $& 0 Q3K@e
0 u @_ @`L 04$#48S
0 $ K⸎ 0 00 004$#48C80C S=P23K @; 0
,$ K⟎
30$0K#0K0"0K0!0K0 0K0 0K
00$0K 0 0 P
# Pj @i 1@ $ K{ 0 43K /@R 3[ S0 )0(43K0 0
3S H L0 S0T 0H 0b
S 00 S
00C0000 $0 00 S$
$K ( ( 02 [ 1 [
6 T ,K ,10 , 0 0KDO P 0 Q
7@0 P
f$ @ K] R
_
- QL,M` p A!(21(2P @K PPT@ 0Z
80 S
@Kv 0 0R Z @Ko\22 0
0I ^ t\2 TH0
tQ S\B T@K T @00 XBp T
00 ƍ p@t2pH0 S
0L0 0 P 0 \ 0P @Lp 0 H0 @K "H0 pT P ("! " ("(K
0- PL @D 0:H T0
"" C C C 0 0@ 0轘]
00-800:00@1 0 L @$0000%0x0 % Q
0 00#0 0X2 FH0t 41<0 0 (0K0h / ဖ D"Y0 Y]\
0- @x0L0p0 003/t\XR U
0 S 0 嗯\20C\2tt&Q0qR\ 0< P
0# ! #2" ! #2" /] 0@- Q
@ T 0.0 R Q0@- @@ Q
00A S PAPE U 07 0 09 Q a0A S A7A 00C Q PAPE U 9 S 0|0 S0| P@
-L`MP` @X K4 pȉ 9 80" lK Tp X% P H
0P S 6 00p0K 0 0XK d 0P6 P4
P1
R- 20 4 0 `p 0Ѐ0`% R 0`px0f06 ; 0 + & ;00X0p 0 P 00p 0 0 $K$
- @ PLT0 S
P P
` T0P`P0CT0
0- L @P
G 0踺 冸긺
0-6L @ @ &
@0@03/P t P
s Px00Cx0 x0 P S L0 S
3/H0 3/ 0Cx0 O> 0
-`pL P (=0 3/ @(<> T 3 (= 0 8/ `(+> V
@x0 0x0#>
-@L =@ T
0 S `
@`0 V 0Q U
p = a > P $Kk=긺
-d@L P` p=@ T
0 S $0 9/ @ $Kk=긺
0- PLL @P 0 S 0(0 <0 0@0 0$00800H00<5Y5Y=Yh4Y5Y
-0@ `P LK= 0` 0 Kh=긺80/
-@L `p 8=@ T
0 S
@0(*= ( P0(= U
P {= 踺
0-LM 0 @PK0%0( = T P
|P@03/ 0(\= P
|@ K04Y
0- @\PL <0 T 00
T0 == H0K0h/Ḻ
- @Pp`LM , K 0(,p (` P <, K\ z$ P
|P@03/ 0(=$ Q
|P40 3/ K5Y<0/@0 /40/@0D0/ / /
-L$ 0 R 000 27@ % 0%(( ?( P 0 S @@0@ 00I @
_\ | P**hsssR
_ 0 0 S / ux
0- @PL
T 0 0 - 00 /
-L @p `PZ P , $ 0p `P 0000
_
- p` PL@ U@ D P 0 S
, P / 0 /
- `L P @ 0P @ T @' 0P 0P 0
_
_ R Q
-@ @ P@ TL`P T \! S
T! SN ` PG
V P>
` v P<
0 S4 0 p S000 0 0p003/ @ Tp @ Y
Y!
P 0
PP S Y ! 0@
$ P @@ T @ @ p 6i(5i
-P @ L P
u `
0#U 0 V00 u0 0 0< " R
R 0 0 /0 /ᠱ] P
P / P
P u / /N / /0H00 L
- `L pq @ R @P0 Q@ P0 U
P P | P0L X0D a !P
Pᎂ @00@0 pi @ ~ @LL
- P@L `p. P0L Q@ 0D 70 @ P
! R R
0A P
ۃ @00C@0 @h I E @LL
-L$M0("L0 @1!("H0 P p@@ KD P `@0P V *0
3/` @ KL0H!(210#(2(KL
-L I 0 @L_L
0- @x2lPL S|" |"|2x" D D 8 D D
K0hޥL000 S
p" R t" R
x2 /L
-L `P P
¥ @pbtR Nu,0 @ 0 R x"||2 LL
0- @PL 0 K0h
-L @Pp`
- P p`@hL
0 P P @ P U T T
0 ]
0- @PL z 0
-L,M @Q0 0 L D0 h P8
0!(21(2H P `Ġ@ KD p PP @0 U * 0L DK:/ 00D p R0 S P P0 @ K,0H T!(210#(2D0 0
(KLNu@-0A @`@@P S@
0-LP@L 9 0 K0h:
-p0L P 0 `Q0CSP P@E E PP ä P @P 0 U * P d
H`LP -t
- P p`p0 @L 0AS@0C@@P 0 W * pL تP E B
$Kk艤-t
0-LM PQ @H
, K⭁ , K@L ت U
U K K"K R K0TY /
-`0`L @ 1PT N `P
PpC F V -
0-L0L P01T [ p @ j{ 0 P
> 0
- P @L `ᬐPp 0 U * 5 P
0P l mLL P E@N`P0 V 0
YL 0$Kk -_
- ` @HpLTP 0 T *
P
@P-
-01 AL R PB H0 QA
A p q ͣ ` 0 X * Ty 0 S * 0H P 0 U * Ƨ P
圧 0P @ K P ᖣ - _
-LM pP`K` H0 @0 0K\0 0` @ 0 0 000
0S?o2 P0 S (K
-LM P` p@K ` 0KT0 0@ 0 000 00 00nS K 0@- @ S *@ !0`@P@
-LMQ ` p# K @ t ` ~0K ` ក 0 00 00T@ DP 0 0 0 5S ` $K[Y- 0 S0! Q\
^010 B S "
䰻 0 S
0 P * \ / /
-0L P@` T P @P P T 00 00 0 0P`0 @ 谻)_ 0 P 0 0 S /0 S 0
0 /-0 S
0
-L M p 0
P R
P P ` Q 0 @ V *0 ^ ` 0 L
P H 0#0 B`g! Q0@@00 T
0
00 R 1 1 P+ @P X!
0
00 R 0 V 40 1 @40 T
S@ P Z (Kp@-0 ` RP Pb Q@ *@ ` T Q
T: 0b
\ * R
p p p0-S>"0 000 ( $#0 0
- @L P`p$ 0 0 \ * Y 00 0 0e P A L
`0 S@1: 0
000 @
` `
-L M4r @ `0 T@ PR
U U E j} e e} ` X *0V F S`
`h Uᨡ 0 S ` ( ` R d {~ ` 0 ` @ P @ Y T B 0 PA @
0p 0 \~ (} 0 0 K Z00 @ S` P
㱸 0 S P U:` 0
0 0d Q`F`e oo`bPg10 V0 00 0 TPÆʛ(K谻0E_]
- ` QLP
0 ] P @ @ Y P T P
0 T
-L$MP 0 `Q< @80
: P `
00 K< 00 @ S@0 p 0:
S
V
V
R
Q D0 H PD0 H PD0 p0 T p 0@ 000P WPP 00P0p SP<0 0 000 00@ V
` @ p R' P SP0 S U
0 S
0 S Q v P P 0 S
R P0 S 0 0 0 V9
0 Sԡ5 80 S 00 W 0 S
p0 X p P U 0
0 0
h 㦷 V 00 0 P
P P
) (Kr_
- PLp R `P @ 1
d ฃ P* W
Z P @
0 R
@ T @0 SC
Q@
0 T 0 S 0 R1 N S
F$ 00C S 0 R S P 0 R
Q $2 0 # 0 0 0P S&
T0 P ` T00 Ta
0R #0 Q
P 0 QPP(0P,0P? 0 T0 U00 R"
Q ࠳ Q0 R A Q 0 R S R
ö` U
P0P 0 VPP 0 0 0#00#0 R0__
__ 0
-`p @L0 S@ P P T
0
@ 6/ P
0@
-`p @L0 S@ / P T
0
@ 6/ P
0@
0-<0L P0@ S 㳞0 P@ 0谻0
- @p`Lp { ( P0pX 0 0p 0 d0(0 P 0 000 00 0谻eYlY^YDeY
0- 0L @ SP p 0P
0K0h 0 0
0-(1L R P
$X \ R P P K0h P @ 坵 m{ 0 0 0 P 4: d P\
XP@ T
P@
0 0 0 0谻*_ D_x__0_
- `LpP @-) `, P
` 00 0q1 0 0 S 0@ @P
- @ P 0 `L S 0 00$ 0@ 0 R
0 p Khꨬ 1 /1M / (
--LM P0(0 0` @ T>
!0 R8 1 S
R2 P
Ⴡ P* P
{ P" 0 S U 3/ P 0 \ P
0 ) P
U (P @ U
0 ) P E ( =$K /0 z 0 z
- P SL`p
0 S
# ! W 1
8@ 0 0 03/ @P 03/ W @
] 9@
- 0L S
傴 _ Q 0 P / /@- 0@ S0 0 P44 04: P *@ ` 0z
-LM40@ 0 P
\ \
S R
K K ᵀ o K
0- @ L P
( 0 P
$ P
000000 л
-00L @ Sp P U
0 S _ ` P
00 p0
-0`LP U,
@ T'
" ? R0 0 S 0 0 R0 0 8 s 0 3/P 0 S0C08
P0$$ $ Khcлໃ_uYм
0- @L( T 0
- @L4 P`80 S ` Kh;L
- @ `PPL (1L L`0C(1Z H`F P Kh蜨л
-P`LHP @ T @ Kh0 0 8 ^ L\ ` P / 0 !`8 0 0 , , ! /hsss 0!< 0`4 0 , ! /hsss
-L8M Pp ` l P
@P
40
8 r P! 0 W!
4 P Kx 0PK LP K
0-@LL P Q
Q
,0
P
L ,0 0,0 P,00,0 L L@<0 S 0P0K0h0
0- PL L P
80 S
3/ @P
0
p- @QML @@0` 000` 0 0c 00< @P
奲 @ D X0 0 `0@ @p 儤l0 (d 0 `0@ @z @@ KphRL_DLԔ]TxY_]l}^__ _ໃ`tY^>
0- @L8 ] 4 ,00 S
t K0h 0 L
-Lp`P w 0 S
@P0 P @) @P$ `P 40
~H0 H PD@@ T
L0 S
H@ T
D@D ᇵ T
0 0 R
` 1 `P
y@ n
-,0L ` SP( U
@P U XP PW
0 Q
N W X 0 U 0
r P @
80 S
3/ @P
800,@ S 000
0- @ L P
P
40 0 C 7 0
0-L P P 8 \ K0h@@ 0 P R0 T00 K0h% LL
-40L @
640| x`PPp U
@D 0`T0P`@ 10 <` @ - ϵ LLDL
0-<@40L@P640 0D P0T0Z K0hL
-PL @ % 0P
0 00 P
.40
P
% 0 0 f0
& W V&ā
0-@ PL8M4 H Kv 04 HKD0 00 @0 0<0 H0 S(1 040 L0 000 0
K0
-LM` p P U + @ P`00 0 0c 00r 0P
۰ ` @P
v 0 p 000 @D0 R 0 K8 MлԔ]dvY_]l}^uYػ /
0- PL@ T
0 S 0 0 R0 0 8 ip 0 3/@ 婥0 S0C0( ǯ0 S 0 0ໃ_ /
- Pp`@L T8
0 S0@ S 0 0 R 0 0 0 S0C0 喯( (v |0`P "p00 S0 @ P 00 0 @ @ 000 喣 @P7 8_ໃr p m /0@-40@ C U T P
40 0 0
0- P @ P L P
P0
-0L P S`
Q @ @ P
0-L @ P Q
P 0 P C 0
- @ Lp P`P
P
P
U
0 0 U 0 0 P Kh
0-L @ 孞 0twY
0- @ LP P
P
0
-L\M ` p P
0< PP P
P0 S @ T
TK ]|K x @PP3
U
) P
H $ Q P & P P7 hK& P
P@K J R R
hK Ph K
hKk P h K P P
hK] P R
h0K4 Z
U P@K Pb UX
@K T |K
@L
X
R P X
( X
8/
HP T |K
qhK n U
H0 S
PHP
40( S0 040L0 S
(0 S
3/ X@
R@
0 @ TP
@P|K 7@K ` TK] (K
-LM @?0 `0 (0 0 L5!(21(2 0P0 0
0P T
T
T- j V
K묀K T ` { P
@P
40LP0 U40
,0
P,00,0(0 S
3/D$ Z(10(1
@8 (n $ A 0 AP U
0 S 0 0 R 0 0 0 S0C0 uM V
0 @ Z 8 m ~
P T `,p W 00 P
K K P pP00
l @P
s 060040 0 V0
0K 0 0 P
P
0 X
P
0 00 S Pm P Lp<0 S 0P0$ Q P PS ; P 0 0H0 ἀ& o1 `P
v c mh廢4 (0 S
3/0 S
K K : Z
@8 ^m Pp A 0 A V
K묀K TU ` s P
Z
8 @m 7`0 S
K P` 3` P` pK (0 !(210#(2 (Kл [_ໃ _DL
-PLTM ptK @ `Pi
$30# P 00 Sx } PA
ᒰ X
? 0 P7 x0L0 V 3 x P
0 S
0 S 40 A)
4 ` Kr 0, K@L0"`K 8@ \p XP T 4` Ax R4@ Px @4 4 Ƞx P
X Q0
^ X
3 Z
4 ` Kr 0 D0 `K0 \p XP T v tK +(K
- @Pp`L8M4 P Kqr 0 PK (0 Lp H` DP K
0- LMK, @ PP d T K0
0-LM@ `P0 P Q p R
KpK , 0P
L0 V
TA 3 = 4 K%r 0, U0 &0 KK0 ` p @P Up
U
U
(0 S
K 3/ Qp K
p-Lh 2?K400 ,00 0101x00 0 S0
S0 00 K 0K
W"
0@x 0 00 K0 @ h |0 1 KK01x00 2:K400 10 x07 P
0 T X~(K<]'_
-L8M00 00 S
@0K P
K <
-L8MP01`00 SF
P0Ku @P@
0
3S HL0 S
T0 b`00a0 < 0b 0 S * pP S h P p
U
0 g 0000 (0 0(00PPS K<
0-LMPP @p D0 0 P
@ P
0 S 0 S
K0 hv@-x:p@0#2 0 00000 a RP P ^ P U`0
pC .CC P轘] 0 /Ḿ
-L M 0 K 踾
-LM @pHP` vc 49,10# W 00 S
0 8 š44 P00 S
80" KK 0` K
-PL @ `Q P
WQ Px00Cx0x0 0x00 0 Kh+QꜽY
- @PL 6@ x0 S L0 S
3/ H0 Kh/0Cx0 5 @0 `( 6@ x0
0Cx0 wp @ Ώ P* 0* я ŏ)@PI ɏ S L0 S
3/H0 3/ 0Cx0 ( Kh긾 0$ R 0 0 0 0 PȾ
0-LLM!3 @P` p0<(` 00p,P$@ @@ @ }= 0!30<(` 0 00K4p0,P$@ @@ @ g=008p40 00 0',!(3(` 00,P$@ @ @P N=008p40 000 0 0!2(` 00,P$@@ @P 6=008p40 00 0!t2,0l2(`00,P $@0 @ @ =008p40 000 0 0!2(` 00,P$@@ @P =008p40 00 0 0 0!1(` 00,P$@@ @P <008p40 000 0 0!X1(` 00,P$@@ @P <008p40 000 0 0!0(` 00,P$@@ @P <008p40 000 0 0!0 (`0,P0$@@ @P < ʎd` 00 @ 0(Ki^^_ >_4^|Y^C_Q_f_v_p^
00- 0 P0 @ 0PL e P P0 - 30 0 /
-L$M@ ` D PPU
80 S 90000 pbp@( @ 5e 80 S 00000 090 0
H0 se H0 @ me 0 D4p$#4 8S ]e 0;0K0,@K0d0 <0 0 ! 0! 0 (K踾
p- SLMj ` @R P , Kq,@K( l1 03/ @(
Kp
0-p@L P P@ T
0 U
@@ K0h +( N H^ K0h긾Ⱦ
0- @L 0 S
0 00踾
-LM0
<00 S
K 0K 5 K ]_ 0 ,
-LM,K ,( 0 P 0P0 S 04
K0 S `PK
K1 t&` pf x 0& @P
80 S 04$#48S0 `0` Kd 0 K4$#4 8S d 00
j ?# Cp Wp l : 0a V V
0 S
` V
`F 0 SpK ᚡ 90 R
Hz $ K K-9 0 KO Vpn p Vp/ 00 [ H pP
pKx n W N H2 SDpC W
00 S
Hp W
DpGpK a W W DY Ҍ%` pe = 9 4
Qj P Y & ƌ K K0K ! 00 0 S 8 媌% 0% R p8 坌' 0'L8 垌0 S 48 厌$ 0$8 双 VL
0 R
SF 0 RC 0 @
\ K ` K P0P `0K 0ǟ
Ѐ
X 0 P0 , `0K \ X7 40 ` S0K @ 㕝 4 㑝 V0 0 0 S
R
S K\ K0\ KK `P \ K (l1\ K 0 `6/ `(1 X
0 K ` V
00 c
9
i P]
0Е셟0
0 SU
\ KU P K K0K 'F @ R
Ӌ 0 S6
\ K6 PᤀK K @0 0 00 0! 곋 嶋0 S
K K
\ K K 0 9
b 6 & \4 H4Ѐ ?%k P0岖 S.
T0 K0 P PT w ` K,K
u i,K k R
0K` s0 #448#8 S
S S G" K b =" A 0` R 0 04$#48S
Yb ,1
0Rb 0 0K K4$#48S0 } (l1 K 03/ `( Vh
6ᬐ
X
)b
%b T pKr 04$#4 8S
b K b 0 0 0 80 S ,, 0 02 0<00 02000,PK(0 00K0h0e0 妊 ` p` ` p0` 奊0 K N
pK K E VP(K踾 hv___*_ O_~___ _
-LM P
4 K 0! S10 040K0 ꬑ40 S Z 03 V
H 㟃`q @ ` V
0 U
` T , 4 KZ 0 S00 040Ky4 T0
H ᳃, 3KP 40 `` 0 0``0 0 ` @0 @ S
`4pK ` * p08 P M$D0 `i 04 !K $K],_@Z^ ȾZ_^lY
- @LMOP U`
, K 0" S20 0,0K 0 S , K 0D"L S@20 0,0K f Q
20 S
0! 0 `i 0 S" #A A R 0 0, ,!0 0,K$ 0a R `h 0`!, 0 S (10 S
`,pK ` p0 㶚00 S 0 0 S 0 0 0 }J ` 00 S
`,pK ` k p0D d ㎚, V
`J HƂ KȾ"]_@Z^,_ ^lÝ^_
- PL$Mp , P
} 4 P0
P
H@ PP " R 4 " R b("!("4 !
! Ѐ
l K$KLH D 9 P
@KiH _ Y
@K c R
2 $" 0$ z 6 S
1 % S R T0 S P P
6T0P娑0CT0 婇* 0* 孇 塇) 0) 奇P0 S
R0 PT0 Z0T00 @0 @0& R# W@
4 @A Z-
,!@0 O&@0 & W
L0
0 < K< K @P
L0
0 i V (K__>]_-_
-L M⼁q 0 P U
0 S 0 0 00$00C$00 U:
0 \-Xa ! 0! 0 S Z
n0 P00 მ % 0% 8 R @ @ s0 T $ 0$ l (Ko@ @@@ 04$#48C8 S
S 7 ˆ# 0#ꨬ S_- /
00-(0,0L@<,00 S
0 S
3/ 00000 D00@000
0 4 R 000 K0htYDYhY
- L ` R& @0000 R : 04$#48C8 S
S 0PT4%T֚ <X PEX
80 S
U $Kk U U
ښ $Kkp80 S
< Q@0 S& 04$#48S
P
Y,1 R0 c P , f] a] 0@0 e( ̾о
-L,ML 1 `@ 8 㤡H < @ D0 @00S@0 N
PP@
90 #0帀b@ ( @ P0 \ 9p p ,! ] P0 04$#48S
,1 0 ] 0;0K0 <0<0K 0KN0KP`K0[ : K,[ T1 ` V
kr 0P K3/ PPA`
0 P dx K_L `T ` @ T<
q0@D T8
80 S1 <0 Y S R* d d KCX0 S
9X`0 :/ Z Z U
dx KC0dKx K `
`P0 d K74@ T0@D U
\0x`d@ S
p W
`07/ x K
x K (KԾ@M
-L$M @`K ` @P 0 p P
\0d S
Z
`0 :/ @P0 40 (K@M
-PL M` p0 U V
0 RY 0 WV 0 WS U VO W
W
J U
0 SE VG
0 S U
0 S; V=
0 S6 9 4@ T;
0@D T8
80 W<00 SX0 SH 0 S 40 t` P40
L m` PP 0 S 40 b` P40T [` P M k l +1 @ B W
W<@
"@l k| P
f| P@ E
`| PD ?
00@ 8p<00 0D W 0
W @0 0P0D0H L 0 @0 0P0D0H L 0T0 H Y
L Y P Y T Y 0d \00`0d0 P
@ P
|D P
|l |(K@M
-pL P W `
U
U
l { l { @P
l Y 0d 8P`000(40,K 0) 0!|3 00
,` 0(p$@ @@ @ (( 0'!,3 0$30,`0(p$@ P @ ( 0!2 00 40K ,`(p$@ @@ @ (p2 0 0!20<4 K0,`(p$@@ @ '0 0 0!P24 K0D2,`(p0$@0 @ ' 0!14 K01,`(p0$@0 P @ '0 0 0!14 K01,`(p0$@0 @ ' 0!10< 00`,@($@ @@ @ '0 0 0! 1 0104`00,@($@ @ '
0 (0 0!00`,p00$@ P0 @ 0 x' X@ * ~ | z o{ 0P80
` 帉8 (K__0_$ Z+^0Zu^Z^__8Z_'_l^ Z__^ _
0-L@M (0 0 @ p`\!0 0(0K0p,`$@ @@ @ 1' 0!00(0K ,p(`$@ @@ @ 'X0 0 0!H0,p(`00$@0@ @ P0( K '$K__W_l^
- 0PL M
S
0 0d dd z @P
T DP <@ ) z @P
( 7 @ KW_r_D_H_ / / /
-L Ml0@ S h0 0 P
0 K 1 P0l0Kȟ]
-L@M P @+ `P '
h0 00 S
l0 S p P
Yl0 p SL0 h0@0 0\p 04p X` <0 000 Θ, \ K0 PPH0 ppp0+ K 0 @- \
@ 0 ^ R
-L M@`0 N. 0 廉 KhR_-_
-LM PQ @*
p@ T @& N P
N P ` p0h `\0( K 51 @P (0@ p0 0R % $K\_`_xs_ȟ]YL^
-LM`0Pp
#(( R 84 B2 B1 B SB @ 5 P PK0 , nM Y00 Y 0 00I 0 0$K R / R /
-' QL M P`b cU P] < q @0 ` 00 KO 0 0 KN 0p p0 KN 0` $`$0 KN 00 Z(00 Z,% *0,0 V0 V030#-0- ( ,` P W Qa0 6& U U`
` U P V < =q W
908 0 [$ P
;0: 4T (K] /
-` L @ R ,p t P o U P e
-LM @`$0 S <
00K( 4 0P4:$0; a2 1a,P0 啎pi7|7pPb( p,P 咎i>̉-< 0c (0 1 , P '00 8吃 0i319 31 0 a $K
0- 0L @ S
3/< K0hp 0- P, 0 C 0 0/ 'p@-P@ R `0 d @ ` p@ /@-@0n @ /
-LMP `p0H000 0 0 Y V P
P
h T0# 03 V`` VL00 V@0 , 00 T0 $Kk/ $Kd+ZD*Z*Z"Ƞ 0@-P
0 n0@ 0 0@ / 0
-L,M@ 0 P@ Tኀᨈ \ S 0 000 00R 0,K )40 80 0@ H0 D0 0p T<0
=
` Zhh 40 V & @0 U40
X X X 0) H0 00 00 @ P40 V0 H0 00 00 0 P
@p @08 4 1D0 4 0D K 3/(KD*Z*Z'Z 00< /
0- 0L88S Ϡ Q @@ 0 0 0 0 <40 0 0
0-@ 0L<0 088 00! 0 00000 <400
-L M P@p 0x Rx
` 00 ! Y
`
`00 a 0 0 0 0 0 0000 00 T 01 0 H0 0p 0 p 00000 <40 0 (K
- @pP`L, BL 0p `0P
0- P@L @ 2L K0h
p-LM P@$ `@ L 0K0$0K 0 0 J P
!( Kp
-LM00 0 P S Y @ ` p 1@ ㈈ᨈ Z/ 0 S 09 3 V *0f 0 0 , P8
`0 S 0 S Zp
a0 :/ Pp R
0 08/0` 0 /a:/ P 08 V0f
0 0 P
` W
`(K
-0L M pP
` @ T
Z 0@ R> 0 S: 0 S i 6 K Q 00 U !00 A P@`
Q S
u @ P@ S U Q @ 00 u 0 S0@ c T
@
U 0 S 0 S 030C 0A `(K
-L M 0 ` Si
P 0@p
T 0 S 0 S0 1T
Q 1 00
00
TH UP R 0 00A
Z !8 1 1+ 0,0 88 0 00088 00 <00 !
R't R
0 Q
0 0 0 00 000 (K /00 S R0 8 0 / /
- QLMp@ u R㡠 `bo
Z!
0 W:d%
40 0 9/0 P40P0h( 00 9/ P00 U0g*000
0 B S 0 J Q PpG0 W# :d(
80 4 9/4 P800e% PE RP 40 9/ P40 P Q e"0 Ud(PB0 0 R W
d (K 0 R
R0 /] R0@-
@@0PA C PA L P P \
l0 S
d 0 0 0-@ A0@ S0 AC ^ 0 S P c
0-L M P @ P0
0 S
?o2 P0 S
e! 4 KI x@D0 S
K!0 0R0 0B @ 0 S
K0 \0 e K0 ]@-0 M Q + \C 0 ܍@H ̍ ^ S L \ \ P 1N0 C0 Q S \ Q Q܍ R /- `
P R JP 5l
R\ JPt
P 0 >
0 ;
08
06 0⃑ iP5I K
038P0 0C0C
P 0C! P2 H RJ@G
5IP 0
0
00H0 SP RJ@.
0S5YR 0<P R 0< @@PP!R
@ 0!2P@@@ 2
R @H P / / R@- 0
@ \
0c t
^ 0 0
0-L MP @ Q K0hE 0 S 0 R Q!
4 KH tPE0 S
K!0 0R0 0B < K0 \0 0 S dK0']8@- @PD D 8 R-
0 \
n 0
- @']LM@
lyH 8 uH 0<*O*
S 4 7 0:=B>0CS ) <:0<:
R * 0010#210 Sl2l"cq' 0& F #~` 0D" `p 0 S R " 0 F " 0 F )] 0 剁<:0<:` PS Z0$ p 0`)00 00SWP U
R 0 tn<: 0<: R 0## :0:pG w R 0) T<: 0<: R 0%"P!:ؠ0: `̐p:
S 0 0) S 0 0 ) ,<:0<:` V pP UP G <
(K 2f'C 0]y_ ?__0]L]! _g _
-<@L8 ` , . 0P P@ ' A R * 0 S
b /- Q *
a0@- Q O
@
S A
@P U T 0C 0\8
C @P U T
\@0 R(
^
PL_ U Q) @ A ,à0@ 8 0@ 0@
\ \ Q PA Q
Q 00@ 0 0 0 Q
0 0 0
-L MԀ`@ PQ4PK T0@K c 0 Q ZW
Q
V S R : S R 0 S "0 0 S R"03 05 * S R (K
-L MԀ`@ PQ4PK T0@K 0 Q ZW
Q
V R V 0 S "0 0 R "0 0 V (K
0B R" S-LM p 0 ȀP@ `D T V` `0- TP@`
+ T@P0 0 T 00X S 00 C R A B R P@p W 0 Tp
p ? "KD K? D 0 0 D ^@ a D RW@D A D R 7@D W #K Q P 0
p Y
SE 0 0 \ 00 S(0, ,2".0 @0$K脿] _
-0BLM R" S8 < 80 xxG@P E U X 0- U@P
+ UP@0 0 U 00X S 00 C R A B R @P Y 0 U
X `q `q ? #K|D ? vD X `p
Z `
i p j 0 0 E \P a E RWPE A E R 7PE Y < R@
S@D 8@<0 @9 X
P0, Q P0 0 Z 00 S# 004 42",0 R V0 Q P0 0 Z 00 S 004 42",0 P0 <0 S(K莿] _
0-L P @ 0000 0 c0 2 /UUUU3333 @-A /
0 S A S /0 -$(0@#
A
A
A
A0 / Q 1 / Q ! / Q 1 / Q ! / Q / Q / Q / Q /p@- @P`+ V P p R 0 0 WA B-`
PP 5
R
` Rg JPe
P 0
0
00C 0⃑ i`P5I 0
038P0 0C0C P 0C+ P: H RJ@5
5IP 0
0
00H0 SP R Z 0P @ < 0S 08 5Y 3 R 0<P R 4 @@PP& r R T P @ 0!2P4@@@
P 5 `P
A /
- pL P W
@ @ ` P
W
P ? P 0@- R
0P@ ^ ^ 0 0 T 0 Q @-D
R
0 B 0#01,#3 P ` e P P ,, A ,| ,Ġ 20 ">< 20 80?"10 ?8 "10 ܋K+K " 0#80< <30 <8 30 ,K " 0#$K܅K&K " 0#܃K K%K܆K %K " 0#܄K 0܈K K V&KK(K'K)K
&K'K$K&K$K$K%K&K#K%K%K#Kd0` ! ! " | #x ! ! "# ԍKlK `& p' ԎKhKmK!`& p'iK` hKK ! `p ԉKhK`& p'LH ! L ԆK1 H nK L Kp'H `&L H K !KdKK `pK !hK `p` 0 'K 0'KT0P #>21 ">T 2 1 P0?"11 ?P "1 1 A?K`C?K p'P0`&T <K31
~ b> p ]> 0P0H > @ > Kh
- PRL @`n
@ $
p` UP : > $ 0 Q P$ $ 0$P Pg`
{> $ Q 0 Q$ U@ pP & g W$ $+ 0 S R$ $ 0$pG
T>
$+ 0 S R$ $ 0$pGg W#SE U
P 9> 0Q S U $ 0$
- `PLP
B @ @@ T =
0- @PL
@ ( > P = 0$$ 0]]P
- `PLP
@ @0 T =
-LM@ p l K= p0 00 p000 p00t0 p0t 00 p0 00 l0ctc0 0? SP p @p` @8 R?0 U L@p g Kh-8
p-L M P@ 0$`K S !1" 0 S h 0~?
S P U
0 # !1" 0 SKp _] 0 !0 00 /#EgvT2ܺ
- @L\M@ l K7 0 lp0 0# h d0# X 0 : b{p ` " " \ b)pak#!c; ȇ" !b+h,! lˠ
( !0Thj0
0# PP ` \ 0*0#L j
0%0#H e[隀0! 0# D0a ) "
0@ ic9 . P pmvmzNS\lˠ p p p' h` b, p!p p'``a`jp"pp' @b+ lɀp& pp' fk ` p, pp'llˠa p p p' X` b) p!p p'`a`fmp"pp' db+ ˀp& pp' 8fk `
p, pp'Hlˠ p p p' P` b* p!p p'`Da`mp"p p' p4b+x&0 ) fk `' ,g{â0) 0# =D i ,\ !`lˠ`f # "ph c;p+P!XP% a iZ "
Lb+`% `&00ciP0e[ ,a͂T` 0& 0# b .,4ğ ",xğn #, \ğ$ 0!,0Dc>
.,᪃$ "
! ğ0n
#! Ď<# 0 * "0#c>
. "
#ꪃ ,
"n#
# ", |#ā 0 * "0d#c> ! .
L*,.0a #. ā0 .$0c= * b+) ) Ł (00|c= ( `0b+ ( < ( (Ł0 (p0c=p p' pb+ ppp'0 P3 : / M?0 V G@P e Kh
/
0-@ PLM K " !? 7 R8 bx b8 K X K0h. ] 0 S * 0@ ,Ġ@@,̠@ / 0G- P @@M`p hdp`pRl`0@ S 0`. `0`&`0n,0!0 , 0 " 0*p0&00#0ꦠ p`0!
00#0`>
`"``&` `*`
`&` j # "
ꦠ !
0 " $0.
0&00#(0 `0*0
0#0,`:!`"``&
0`ꦠ
)4 鎠ܔ
# "8 0 *
" <0*0(00#
6
hꮠ
D
+
0 3陠0
00
3ꮠ0
00ਃ$0
0 40|#苠 00
X3 陠0
0 00
00#>
(#
8"苠
崒)
0 0 匒>
,d
<<苠
) 0!)0> p(p'q
pp"p'芠`#`& p a(ᘑ`0`!`&0(`>p `(`&`aX`p"8`p'芠
`#`& p a(`0`!`&0$`>p `(`&`ؠ`p"4`p'芠
`#`& p `(ᘐ`0p!,`p'0> `(`& p``X`p"<`p'芠
`# `& PȌ@ P @@ЍyZn 000 0 /#EgܺvT2
- @`0!L0 R00? @P`000 Vp>0 P3 : - *?0 V $@P e Kh,
0-@ PLM K !? 7 R8 bx b8 K X K0h, Z] -` a!`.4 a !
`8 8#4-`D# 0`.p|PL0
4 0E
h4 P E
4 0E d^4 0P00 E E0E`VP@p@$DPC-p 00 C Rh 0 S @
P 0 X R@P @P0 `L
0C Y U 8@C T\ 2"0 BU U P 0 C PH A @ PC . S R ^9 * 0 S
P1 C S \< T 9
g ^
^
^ R05,1 : R *0 8 < R 0 8 < 4 Q
b8"8#4b$# "40"8",0
a0C Sa0A0 0c" 0@ Ѝ
-LMKw P K /
-Le _-M
Ѝ
-LMK 2 K K
-L M 2 K Q : P : / / /
-L @ p /@- HX $H%X&XhȠ&h "Ƞ!&H%Ȏhx$Ȍ&
-oO "L R0# M$K0! P 2 K P! K Q P : / / /
-L @ B?Q R / bQ20" / P Q a o@ ` / 0` o ` / P 0a P o a / Qoo / @-p @/ ?!B C @ @- p@ P` !L N3 !@ A 8 01 32 32 31 0 S 0 0 b0 /o /
Q - 0aL P( P ! 6 ] _
0- @ PP R 0L T0( T0 ! 0] _000 0 c 1 2 ? /UUUU33330` 0@-tP@ P00"AO\ #Q @ P0 ". !2,0 0UUUUUUUU33333333
P -L ` ]T _
Q P -L p ] _
P-L P@ Q Q P %t t /?` !`bc Q V ʔ R V( 0 a~ V 5] _
-QLM P @P`p S R ! B S R Q P 9 % l $ R 0%Ǐ 0"K & R0'0#K"K R 0#K R 0 \
5# P P#K q( "K P0@ 0 r 0 e( "K P0 5$K] _
P-LP Q 0 /? ! @bc Q T R a T0 0 Q P
-L B,Q PP- S R% 0$ o P! " R 0# 0 X R \p V V
r 0( P 00 0 S R Q P
Q -0L P( P ! ]\ _
0- @ P R 0L P0( P0 ! 0] _
P -L ? c ] _
Q P -L / ! P ]" _ / R C /A 0 \ R# R!
R / ` o ` /` `! / / /
- L Mp @`
P U" * T
4 0 } 00 P
0 P4 @ Q ! Q P @ 0 W V S P(Kyaratcid0 S /0 S /
0-L P @P
0P 0
-L ` v @P
$ p PP
$ P UP g 00 0 00 0 /
0- 0L @0C S 0 0 S P $ I q K0hC 0
H 0-L; @P
0 0a 0
0- @PL
P
0@0 Q 0 P /0 S 0 / P /0 S 00 0 / /
- PLPp @P
U * `P
P
0-L P Z @P
P 0 0
0-L P W @P
P r 0 0
0- @PL 00 S
0Q0 S + P
00 V 0
0- @PL 00 S
0Q0 S P
00 < 0
0-L @N P 0
S * 0 0
-L M 0 @ S ,0, , 0( (0r 00 0KK _@^^d _
p-L M 0 P S h0h h 0d d0X @@D T @` 0 T * @rH KphD KpW _@^^d _
-P 0L M @40 p W
`80K `0 K
Q PR
80 S X@ = `<0K4 K C800` P04` 4 S
S
; Y
U80 4 6 P4 4 ( Y
U80 4 " N P4 4 P Y 4 v T4
P P
4P p(K
-L M PS@ `p @
0 0 P@
r o XO@ 0 j @ K
0 -LM 0 K
0-LM 0K@ 0 K 0KP P 0 R 0 R
R P K0
-L P` j @ P
-L P ` @ P
-L P `6 @ P p
-L P` w @ P ^
-L P` 3 @ P L
0-LM@ 0 K 0K8 P
0 R
R $ * P K
-LM PR @`
0 0 P
p WO @
K
0- PML@ P0 P
T K0
0-LP@ P w TO 0
0- @LM 0K @ K P
0P U
U - K0
0p-L M` 0 @P P
G PO Kph Kp 0=
-@p 0ML` 0 P P
* PO Kh K 0gnts 0atad 0rbmn 0loob
- @L P` 0 Kh{
0- @L P K0h>
0-LM@00 Kj PP T
K0loob loob
-L @P `X 0 KhG
0- @PL I K0h
0-LMP@ K@04 P U
T
| K0atad
0-LMP@ K@0 P U
q T
b K0atad 3atad
-L @P ` 0 Kh
0- @PL K0h
0-LM@D0 K P PPO T
K0atad
- @L P`{ 0 Kh
0- @L Pm K0h
0-LM@00 K PP T
K0gnts
0-LM@00 K PP T
K0gnts gnts
-L @P `U 0 Khv
0- @PL F K0h8
0-LM@D0 Kd PP
T PO
T
K0atad }rbmn
- ` Lp P( * ℣ PP%
vo @P
ᛣ 0@l0 W
d0 W V@ ` ሣ V ` T yaratcid
-L M0 p1 0@ 0 P
0 P! P P
) 0*$K. `0! #1 @P ` ( =p @P(0H H V Kyaratcid
p-LM@@@P@` T
* 0 0` 0 OKp!_"_t0 qyara0 '0 htcid0 ' Q _ /yara0 0' Q T /tcid0 0'
/
y /
0- @L ɢ P 0 @ 0000 / / / /
0- pPL 0@0 S
0 ` V
0 3/ P 0 0 0 0 P S
0 0 @
0-L@ PP 0 0 P P 0tcid
0-L@ P 0 P 0 0loob
- PL `f @PP
P
0-LP @ X0 P
0 P P & 0 - Q Prbmn
0-LP @o X0 P
0 P
P 0 P 0rbmn
- PL` @PP
P
- PL` @PP
P
0-LP^ @' `0 P
0 P P 0 0 Q Prbmn
0-LP; @ X0 P
0 o P
n P 0 P 0rbmn
- PL` & @PP
? P L
- PL` ! @PP
+ P 8
0-LP @ `0 P
0 ' P & P S 0 Z 0! Q Prbmn
0-LP @ X0 P
0 P
P = 0 , P 0rbmn
- PL` @PP
P
- PL` @PP
P
0-LP @R X0 P
0 P @ P 0 P 0rbmn
0-LPi @2 X0 P
0 P
@ P 0 P 0rbmn
- PL` T @PP
m P z
- PL` O @PP
Y P f
0-L@! P
$0 P 0 0gnts
- PL ` @PP
3 P @
0-L@ P
$0 P 0 0gnts
- PL ` @PP
P
0- @RL
P
0 0
0-L@ P
0 P ` 0 0loob
- PL `C @PP
P
0-LP @l
X0 P
0 P P 0
Q Prbmn
0-LP @L
X0 P
0 P
P 0 P 0rbmn
- PL` n @PP
P
- PL` i @PP
~ P
0- PL G @PP
P n 0
0- PL 5 @PP
P \ 0
0-LP6 @ `0 P
0 K P J P w 0 ~ 0 Q Prbmn
0-LP @ X0 P
0 ( P
' P ` 0 O P 0rbmn
- PL`
@PP
P
- PL`
@PP
P
0- PL
@PP
P 0
0- PL
@PP
P 0
0-LP @Q `0 P
0
P
P
0
0! Q Prbmn
0-LP @/ X0 P
0
P
P
0
P 0rbmn
- PL` Q
@PP
u P w
- PL` L
@PP
a P c
0- PL *
@PP
} P Q 0
0- PL
@PP
k P ? 0
0-LP @ X0 P
0 .
P -
@ P Z
0 a
P 0rbmn
0-LP @ X0 P
0
P
@ P F
0 5
P 0rbmn
- PL` @PP
P
- PL` @PP
P
0- PL @PP
P
0
0- PL @PP
P
0
0-L P i @P
P
0 0
0-L@{ P% $0 P 0 0gnts
- PL `C @PP
y P {
0-L P J @P
P k
0 0
0-L@C P
$0 P 0 0gnts
- PL `$ @PP
A P C
0- @QL
d P 8
0 0 P0 / ]@^0@- \ Ӥ P P?
P
P 0 0 P" 7 t@t D T \@@ @ P \ P(
P
P"
\ : $$
?o23 N P0 T0
N U T : x x0 S 0 0 0
-pL0@ 0ŅP V 0 0d 8 WP@@ V<0P 0ŅP Z
X ? 4 @< P Q< 00 V0 4[<0 ŅP, 0 S-
@0 S* R00P c@l0< V>0@ 0ŅP V 0 8 d40 DW40P X@P @ V ŅP Z @ V ŅP,0 40
0 Q <040 0i 0 S,
H0 S) Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 VP Y@P @ V ŅP000 0 Z 0 S
H0 S Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 VP Y@P @ V=0 0ŅP%Kd 8 V P L 0@ V P S #
2 Z
H0 X : Y<0 Pc@0@h00 0 V>0@ 0ŅP V 0 0d 8 VP Z@P @ V#0 0Ņ,0
P40 00 RD q
D 0 F Q
: Q
= Q
S Db Q
f Q|
M D0 $ H
0 S QD0&
Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 CVP@@ V<0P 0ŅP Z
C < 4@< Q R@ 0< V< 4 [@0 ŅP) 0 S.
H0 S+ Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 VP Y@P @ V ŅP000 0 Z 0 L0 L0K X0 %K P 0%K 0 00 L0 0 S RX0%
Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 UP@@ V<0P 0ŅP Z L 4@< Q R@ 0< V< 4 [@0 ŅP T0 Rv D0= S6 0 S)
H0 S& Y
P<0c@0@h00 0 V>0@ 0ŅP V 0 0d 8 qUP Z@P
@ V=0 0Ņ
P @ V=0 > <0 40 000 000 0 S
R @ V, 0P) H R Y
P< b@ @h0 V> @ ŅP V D0 0 0P d 8 *UD0 Z@P
@ V 0ŅP 0 0 S0 @ V#0 0ŅP ,040 40< S
@ V>0 0ŅP @ 0 0 R0 <040 n
D0F S"(K _<^K^
00-LM@0@K0 /
- P`L @ n T
- `pL @ P yn T
-p- PL` @ jn TKp
0- PL @ D\n T0
- `pL @ P Nn T
-p- PL` @ ?n TKp
- `pL @ P /n T
-p- PL` @ n TKp
-LM Kx K
- L M `d
,s0@ S(
00 @ p @g @`F$p`pdt' PdPgV%@g@e%F$pepdx'PdPgR%@g@eA$pepd00u'PdPgে% 0C S P
S
S
0\ 0X0 T p S S
S
S 0|0x0t0p
@X SV
S
S
S 0L0H0D 0F q 0@ \ 0" P L@ Pp@g@eF$pepdt'dg(@g@h(F$phpdx'dgূ(@g@hA$phpdu'dgে( \ P 0 L 00T0 \ 0L 00p 0 \
0L 00@0g0e6#pepct'cg!0g0a!6# a c("cb!0b0a1# a c%"cb '! 0 (Ky7|]0 -P@
P
0 S R P0 / P 0
P P 0 / 0 /;;
- -LM 0 0 S R K | B 01 R / b120" / B R / 0b03 / QJ : / P /1o?o 0CL /P@ P@ P@ P@
P
@
P
@ P @ P @ P @ P @
P
@
P
@ P @ P @ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P@ P @ P @ / ! @-p@ / ?!B C @ 0 S /i
0 - L R _
0-, L
F @P
00 00 0h]
0- @L0 P
G 0h
P -L
0 R ,0 Q P o @^
0- 0P SL @H K0h
P
/ P
K0h 00 _
-L p @P
q P ‗ `P 0 ~ ` P
0-L P @P
P W 0 00 0
- PPL p0 Rq @P
0000 K `P 0 QG ` ]@^
- PPL X0 RI @P
) `P 0 Q% ` ]@^ P / 0 R /] P / 0 R /]
0- PPL 0 80 R @P
0 Q 0]@^ P / 0 R 0 P / /]@^
-L M @P` ' ?o 2 Q0 S 0 S P 0Pp P
H0 R S0 , Q P P
Ζ K]@^]
-L M @P |0 R` PPp Ꮦ `P
0< S0, \Q P` P
K]@^] 0P-
?o, 2 ^0 S 0 S ]
P -L
,0 R 0 P o ]@^
-LM$0p SP
`- ` V+ `$0K P#
$ 7 @P
0 0$ 0K P
0$ S ` @ P
9 P$0@ 0 : K0 _ 0 S
- S 0- S0> S / /0 0 / /
0-P0L @ Q P
0< 0 P0
0- PL@A Q
P 0
- @` PL 0 U * P
P< P
P
> Kh
0-LP< @ P
/ P
P
> P
K0h 0
- @` PL 0 U * P
P< P
P
/ z P
> u P
Khn
0- @LPA Q
< Q
> Q
& Q
8 4 r P 0 Q 0J _@ _E _
D0-L @^ P
, h P
K0h9 0]P _
,0-L @x P
K0h(0s _
0- L @P
P P 0 1 0,0 0 0(
- pQL @P
b 0@0 S 63 < P
0 S
! S 0- S0E?o 2- R0 S P/ S PE U0 S0(0 P(P` P 0B0 S0300#0> R/ R
R`0a W0
X P 0/ S 0P$0 (0 S0$00> S 0> S 0 00 0 0? 0 S
0@0 S <3
P
0@0 S0>300#= P 00 S
P u b 0" Sp0 S 0j
" P
P0b b > R]00 0@- P PU
< P:
& P0 @a T
@m T @p T6 @; T3 " l T t P, ; P) < p T$ o P! s P ; P ' g T t P ; P > Q
^
* S U 0q T
0 u P o P t P ; P" 0
Q -L & o
p-LIM PIKj `@ R
0 P @
T @K?K @J/KM KIKy P'
@,1 M KIK(A4/04a M KIK3/ P4101
`K?KJ/K KIK_ P
41 0 K,1IK(A4/ P
0141 0KpP]
-L @, ㋓ PP,
`@ @ 0B0 S 63
@< R p P 0> S S S ጓ X P
D P
@ @@B P
@ d _j _y _n
-LM0 IK 0a 00 S
3/@0 P
P
U7
5/5 0 KIK03/ U `
5/ V*
V
V$ p01(1 (Q 00 S
3/`0 @
P 0J K03/ P T
4/ T
4/
p 0 03/ 0 K 0 IK P K
-LP[ @P)
P P $0 S P
0t P
P
PP
0 `P {P s _^ P 0 /
p-PLKM8 IK< G U 0nK 0 0 @P
@[ 0 P`00 0 U
o`] 崙P
-$ L 0 S
V7 K hc$'D[P
0-$@L P x 0` ]
- ` @PL U
0`
q| P T ` PE¥P T
`
0-@L K0h
0- P@L @ i i P 00 , S < S ?hXÃHă
0- @L 0T0 0C0|
p-L M @P 0 R
S
ۏ 3l ? 1` P `
0 0 C P
0 0C0U ` Kp`
-p PL `ᑏ @P
U
! U @p
ᤏ
-LM@ p `i P ᎏ 0P 08 0 x PP
(0 S |+ 0 k P
(0 S$P U0 0 (0K P
(0 PT 6 P
0 P
P0$ P
$K] _([
- PPL@`
`0 R V P@ @ V ]
0-LP< @* P
P
K0h? 00 _
0-L P @P
,0 0$00 0P0 0 0 0L[![
-`L @ J0 S |,Ko0l P>
?o2 S7 *@q 0 S3 P 00 0$ + 0 S& 00 R" P w P
P
- P
P
0
0 3/ P
PP
V @ 00C 0 0 U * w P
P @ D ]] _
0-@ P@ L 0 0 0K0h-
- @PL&
0 R$ p `P P
0 U * 0兑ᅡ
0兡 0P 0000 ]
0P -L
00 R P
000 ]
0- @P L} 0 00K0h
0- @PL
00 R P h @ 0 0]
- @PL`
L0 R P R0 S@# * 4 @ ]
0- @PL ; T
$0 R @ @ 0]
- PPL
x0 R @ `0 V * 0 u pP
`p l W A ]
- @PL`
@0 R P N @ O ] 0P
?o42 R R 00 S 5 /]
-LM @P
2 R 0 p 0 K PP
@ , 0 S
L4 [ PP
喖1 哖
P, U < U U @b C; P `
P|3 tY PP
\n H P8e U
0 Q V `P ` V P
00 80 J P
80 S0C00 !
F 0 P 0 0 bF @ b! 7 00 0Q 00 1 000 00 0@ (K]$'D[PThXÃHă ]
-L@ TP` p Ẍ T
I 4 P
@0 $Kk 7 0 0 0P-
?o42 ^0 S 00 S ]
-LM @P`)
0 R% P 0 K 0 P
0 p` b! 0 0C0 00 0 K] 0P / ?o( 2 \0 S / 00 S /] 0P-
?o, 2 ^0 S 0 S ] P / 0 R / ] 0P-
?o, 2 ^0 S 0 S ]
P-L `Pp7
@ T P * _
Z W0 S
@ T
0 0 0 0 00 0 0 P
@
0-L P @P
c P ȋ 0 0 0 3/ P
h P
P 0
-0L p S@P 6 `P
$ Q ` か 0P 1 ` Kh |]
0-, L9 @P
d 00 00 08Ńl]
P -L
0 R R
o
0- @L0 P
^ !; 08Ń
- 0` SL @l ,KoV PR
PL ` V$ 0PpU("#1 '# P?p<
P6
P0
p P*
`F V ,KoD V pP (1 p P
'"020 P
VpQ = P
= P e^l]
- `L MP@((" p QU
A \ 2̠
< Q0 K
= QR
PC
0 V0[0[0[ 1[ U ` T5 * i U
X, i @` U
X i @` U
T * i @ ` R< R p
B Q = R
+ V0 Z @ S " R
V t1[t1[H1[1[<
L < R
R
B R1"
@ (K]
-LP p P U @
- `P ` P
0-L P@ P0P @000
- PPL p0 R @P
0000 0 S
`P
` l] P / 0 R /l]
0- PPL
H0 R P
Չ @P
0 0 0l] P / 0 R /l] 0P-
?o, 2 ^0 S 0 S H l]
P -L
, ^ \ o l]
-LM$P` U@I P
0 ! P@
0 S=
K 0$ 0 R2 $0K P)
$ k PP#
$ 0 0 0K P
$0 R \ O P
@P q p WP jp$0 0 @ Ky]e^ /
0- @8 L 0 S
(K0$0 T @@ 0,'6[(ƃ
0-0@0PL 0 0 0(ƃ]0 Q{ _~ _ P /?o4 2 \0 S 0 S P / /]
0- @PL
0 R 0 0] P / 0 R /] 0P-
?o, 2 ^0 S 0 S j ]
0-0L@ S $0 S
0 ~ 0~ _00C0 / 0 P 0 S
00 / /
- `PL
ᜈ PP PT 6 @P
Hp p 0 P`00 0 U
ᡈ@ƃ]
0-@LR K0hN
P-L `Pp,
@ T P * ܽ
Խ0 S @ T
0 0 0 0 !0 0!0 @
0- P@L @ ᮽ z P 0
p-L M @P0 S
R
> ▽` 7 1Ca P `
0 0 P
0 0C0 ` Kp@ƃ
-p PL ` @P
U
! U @p
-LM@ P p` P 0 0 0L P
(0 S
@( @0 Y P
Ko^ C[
0-L P 㱇 @P
,0 0$00[ 0P0 0 0 08:[l>[
-P`L @ 0 S m Kh P @2
?o2 S* 0 R pP 00 0
PP
0 0 3/ PP 00C 0 0 U * _ P
P @ , o^]
0-0L @ P
00 Q
0 Q 00 000 P
0-@ P@ L 㡼 0 0 0K0h ut
- @PL
0 R p ሼ e `P P
0 U * 0 0P000 Ҽ ]
-L P000
0- @PL
00 R P V @岼 0 0]
0- @PL
00 R P A @坼 0 0]
- @PL`
L0 R P +0 S@# * @ ြ ]
0- @PL T
$0 R @ @ g 0]
0- @P L 0 00K0hT
0- @PL @ @@$G 0
- @PL`
@0 R P ػ0 S 0 @A0 ]
- @PLP`!
0 R p ύ0 @ 0 S @ 0 0 a 00 0@ ]
- @PL`
<0 R P ᐻ @ ]
-LP ` U@p
P Kh 0 0
- @PLP'
0 R# ` Y0
Kh豻 0 qQ0 R * 0 P0C0 0 0 0圻 Khq] 0P-
?o, 2 ^0 S 0 S D ]
0-L P @P
X P 彅 0 0 0 3/ P
] P
P 0
-0L ` SP@ a P
$0 S Kh zo^
- `L @ P Y T
0- PL @ Y T0
- `L @ PD Y T 0-!00!! 1 \1 0000000#0. 0#0000! R0 Q000! 00000
-@`L1 SU P& T1
! R
R
S
1 0 T6
@``@ T
S
Q
Q
! R
|1 !000 Khr0
0 00 0 /
-` PLp U
@` 7/ P
Q
- @p PL U
`` 8/ P
@ Q T
`
- @p PL U
`` 8/ P
@ Q T
`
- P p` @L W
`
9/ PW
q0 P R 0 0 R0 R Q 1,
@@ppT P
000 0 W
@0@0
0
! R h o 000
- Q" Q
1 `0! R Q
\ c Q c
- L P`@0
^ R \ 0 T T 0 \00p R" /o"` p T 0#0 0#0000000 ^ 000P0 T000 " ` X Pp```& T` \
\
0 1 T
00 00 00 00, ,0 0 0000 000 T 0 V00
$Kk T
00 X0000 `00 `
0 S R P /0
P /- `
PP 5W
PP 0 :
0 7
04
02 0⃑ iP5I 0
038P0 0C0C P 0C H@5IP 0
0
00H0 SP @ 0S 0 5Y
0<P \ 4 @@PP /
0B R" S-LM p 0 U=P@ `D T V` `0- TP@`
+ T@P0 0 T 00X S 00 C R A B R P@p W 0 Tp
p ? "K K? 0 0 D ^@ a D RW@D A D R 7@D W #K Q P 0
p Y
SE 0 0 \ 00 S(0, ,2".0 @0$K(] _
-0BLM R" S8 < 80 xx<@P E U X 0- U@P
+ UP@0 0 U 00X S 00 C R A B R @P Y 0 U
X `q `q ? #K ? X `p
Z `
i p j 0 0 E \P a E RWPE A E R 7PE Y < R@
S@D 8@<0 @9 X
P0, Q P0 0 Z 00 S# 004 42",0 R V0 Q P0 0 Z 00 S 004 42",0 P0 <0 S(K1] _
-0B R" SL ` 0 ll'<P@ pD T Wp p0- TP@p
+ T@P0 0 T 00X S 00 C R A B R P@` V 0 T`
` H
00D \@ a0D SW@D A0D S 7@D V
P ` Y
RE 0 0 Q 00 S@ @9] _
0 S
S / P /$(0# @ / / / / / / / H-M 0Ѝ H-M 0Ѝ
-Lp` @P 6& 0@TP0@
-L ÏO " R 0#M0! P `$p$ P!$K 0 R R!
R / P /0@ 0A0 S} * Q : /@- R ( 2 R R @-PPPP R rPP B@ PP R R00 B R000Ѥ000l \000Ѥ000 R
\6
R B0 -.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0 -.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0 -.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R ' 0 R @- R P1P P1P R rP1P B P1P B@ R010 1 B / R0q0`0q0`0q0` / \0q0`0q0`0q0` R
0 \6
R B0@-81, Ġ%̌T$\D#L0P R0@ Ġ01#̌ R R B0@-81, Ƞ%ȌX$XH#H0P R0@ Ƞ01#Ȍ R R B0@-81, ̠%Č\$TL#D0P R0@ ̠01#Č R0 0 Q > 4 4 8A0 Q" Q Q ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ / Q ̠ ̠ ̠ ̠ / ̠ ̠ /Q0 / / Q00̤ 0 / b0 R0̤A0 Q Q /0 Q0̤ 0 / R. 0
\ B BѴ Bôr - B R5 @P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R @P`p@@P` R@ /@@t @P B@@P B@@P R@ / R / R Ѥ ä / - \{ F
,DP`pL%T\&dl't |@P`p B R R ,DP`pL%T\&dl't |@P`p R / RAn ,D R L@Af ,HP`pH%XX&hh'x x@P`p B R R ,HP`pH%XX&hh'x x@P`p R / RA: ,H R H@A2 ,LP`pD%\T&ld'| t@P`p B R R ,LP`pD%\T&ld'| t@P`p R / RA ,L R D@A / R Ѥ ä / /
0 R / ! 0O / 0 #4< 0 / 0 8 0 / 0 #<4 0 / "4" 0 / 0 0 / 0 "$$#4 0 / 0 0 / "80 / 0"",$ / 0 0 / 0 #4"<0 / "4" 0 / 0 0 / 0 "$$ #40 / 0 0 / ! 0O 0 0 / 0"$,#4 0 / 0 #( / 0",$# / 0 # 0#<4"$0 / 0 0 / !<0!40"440 / 0 0 / 0(#(0 / 0 #$#, / 0 0 / 0 4 "0 / "$,! / 0 0 / "$$! / 0 0 / ! 0O 0 0 / 0 #4< "$ 0 / 0(#88 0 / 0 4",$ 0 / 0 0" ##<40 / 0 0 / 0 !Ġ"ĠČ#4<0 / 0 0,8( / 0" (#8 0 / 0"" #< 40 / 0 0 / 0 #<"4$0 / 0 # # "$, / 0 0,80 ( / 0 "ĠČ!$ # / 0 0 / ! 0O 0 0 / 0,,$ ,#$! / 0( #8 8,0 / 0 $ #< 4, 0 / 0" " $# ,̠ / 0 0 / 0 "$$ #$ <,$,!0 / 0 0#8 8,ȠȌ!0 / 0 ,#88"(0 / 0"Ġ ",$#< 4, 0 / 0 0 / 0"Ġ ,#$<,4 0 / "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0 / 0 "$$#< 4,̠Č! 0 / 0 0 / R4
R0< / B$ 0A00 0 P / R / 0 P / R / 0 P / R / R
: 0 R P!
@ P /LA 0 R P!
@ / 0 P0 / S0 / P0 / S0 / P0 / C / 0 11 /
-p L @ Q`P Wx P
`P1 0 r 0 P
0-L @ \%
^
Q R S T0 0Lx L Q R S " T 0 0 0 0
-L MP0 Q p`@00 U
S
" 0 0 00 S ` p` R? U
00 S
0 0 P
00 S
00 p0E
0 R e o0 `01 s ?o/o0b S 00 S p`h 0 c7s6 8 U) B 00 S 00 T P
d@Oo @d 0d7t6G ?oo
c!0 S
S @ c7z6?o/o0b S0 S oo < 8 cK`܃Kp`pD @ dK`Xp0S` p00 S ` (K Qm : / P 3 /1o?o 0C͏LL 0 /P1"@ P1"@ P2"@ P2"@
P3"
@
P3"
@ P4" @ P4" @ P5" @ P5" @
P6"
@
P6"
@ P7" @ P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0" @ P0" @ / ~ -M
Ѝ Qs :o
Pj :o?o 0C͏LL 0 /P1"@ P1"@ P2"@ P2"@
P3"
@
P3"
@ P4" @ P4" @ P5" @ P5" @
P6"
@
P6"
@ P7" @ P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0" @ P0" @ / / 0 0 /
-L)1 _ 04 8 < S
$ S
$ S
` S
$ S
/ Q
0 0 / Q
0 / / / P P 04 8 < S
$ S
$ S
p S
$ S
$ S / / Q
0 0 / Q
0 / / /
-LM R
00 S$
0 + $9 S
0 S0 @ S S ! S " S S# $ K K^K^
0-LM@ P ( Ki / 3g /K0L^]0!(21 ( /0M / \0 0 < P
/ n,LTF
-@!1`pL 1 Pz x;` C(R 1 S 00Ӳ! 1 11 U; S
Q
0?0$KkG蜽
- PQpL ` {C P W @( d * PT
0L00+40 400 0P0X0 0H@ ` \00
0 U 0
p ` n Pk 0P \Pb
3S H L0 STP0b`PP VX
0` V . \0 SX1P U V : p V c X. X U= @> X: A B R4 0 A B R
00C S( 0C- S X$ 0B 0b q
0 AH X V 0. S 00 U
S 0b0 AC X 0 0lO
-`p @LM |PK. K&) .L`K !) . )` 0K X/ Khp^0!(21 ( /
-LLM( @aP,p ` 00 ```&` R 0 S 1く "44"8 P#R 0 #0
3 0H@ P
r R6
0lK S 0 S 0s 0 0 0 P
(01 H0[
X
0 " P
(01 H0[
X
0 7 0 S
+ P
- 6 J%0 S 0 &4"4 8#8 ! R 0 1 &4"4 8#8 A&4"4 8#8 1 0(K C- P0H Q"
<`p, X \ 00 R0 S P 0 S
@@ Y S
00 R
ӂ
-L(M%U(22(2 kD @pjXH1f)
Y}D1*
N = I,Qv 9z뷸VǢ 놅zl뺫l뗿 2P2akV@oD 6w(4 d<
< *4 P ŋ@H R}Tjt뚹: % pyU y(멄 y0
߸08S l - @pF Hc봸`A@D3 @g*40040* : 3 pG %$)< UX Q* /Ul gUyW f*W:문Yx2 @@02 @ 00`e P9 yvj6 'khBhr hq P-
L,0 00 S R" !& r *|@ 1 "1@ @ `1 01 fi P7
w-hĿ14@K | p1 {1 @ T
{#K<, A ? @ A B C D E F G H I J K L M / 5 7 < ? B C E G H I J L M N O P Q R S U V W X Y Z [ \ ^ _ [ $[ m1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
'(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FKT]
1 ! 2 "
q w W ^ a
z
'3 # &4 $ e E = s d D ` x 5 % r R + t T [ f F \ c - - @ 6 & !y Y ] "g G ; #v $b B _ % &
(7 ' )8 ( *u U { +h H : ,n -, / < .09 ) 1i I } 2j J * 3m 4. ? > 680 ~ 9o :k ;l L | =>@ Ap D
FPQSTXY]
< d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !
e@f@$g@tg@g@qR hh@Sh@qR lsl lsr asr ror ]] ]@^ ]@^ ]@^@]]P]]`]@^_ M]]P
]] ]j^ @ ]] P ]] ]] ]] ]] ]] ]] ]] ]
]
]
] ]
] ]
]p P ] ] $](]p ,]0]p P 5] ] ]
0^ ]
0^ p
:]?] p
0C]?] p
`H]?] p
pN]?] P ^?] P T]?] P @X]?] P P]]?] - ^] b]]
f]j] o]j] f]s] o]s]
E^E^ x]E^ {]] ]] ]] 0 ]+^ 0 0 ]+^ 0 0 ]+^ 0 0 ]+^ ]+^ ]+^ ]+^ ]+^ ]+^ ]+^ ]@^ ]@^ ]@^ ]@^ ]@^ ]] ]] ]] ]] ]]/]]o]p]0/]] p ]_D^ ]] @]] ]] @]]]7 ^ ]7 ^&]7 ^-]7 ^4]:]>]:]E]:]L]:]
l^S]
r]S]
@ ]S]
` ]S]
^S]
X]S]
\]S]
`]S]
]d]
0h]d]
PuI^d]
pl]d]
h]S]
p]t]
o^S]
x]t] ^|] ]] ]] ]] ]] ]] ]] ]] ]] 0]] @]] P]] `]] p]] ]] ]] ]] ]] ]] ]] ]] ]] ]] 0]] @]] P^] `]] p^] ]]
]] ]] ]] ]] ]] ]] $](] ,](] m^0]5]9] >]]0_]@B]]PF]]J]N]BC^N]S]N]X]N] ]]]b]] g]]0l]] q]]v]] {]]0]] ]] ]] ]] ]] ]] ]] ]] eq ne cs cc mi pl vs vc hi ls ge lt gt le nv da ia db ib ed ea fd fa fa fd ea ed s d e p p m z @^@^q]w]@^@^{]]@^@^]]@^@^Ck^Q ^0.0 1.0 2.0 3.0 4.0 5.0 0.5 10.0 lr@tr@XCT _bus_dma_busaddr_to_paddr ]-]-]8]F]T]g]|]]]]]-]]]] VA ]\[2 PVA !]\[2 VA ,]\[2A VA ]\[3 VA ]\[3 VA
]\[3 p A ]\[3 q A ]\[3 qA "]\[3 qA *]\[3 qA 2]\[3 A <]\[4 D
C]ܳ[4 D
J][4 i
R]\[4 `Rf Z]\[4 i
`] [4 qA h]\[4T rA p]\[4T tA x]\[4T tA ]\[4T A ]\[4T A ]\[4T A ]\[4T PT ]\[4T `A ]\[5TE `A ]\[5TE `A ]\[5TE %V ]\[5TE WV ]\[5TE i ]ܲ[5TE $i ^[5TE 0$i ^[5TE ,i ^[5TE 0,i ^[5TE .i ^\[5TE 0.i + ^\[5TE Ai 9 ^[5TE !i @ ^ [5TE !i G ^ [5TE )i @ ^ [5TE )i G ^ [5TE -i N ^ܱ[5TE -i G ^ [5TE Ai Y ^\[5TE Ai g ^\[5TE Ai u ^\[5TE A ^\[5TE A ^\[5TE `A ^\[5TEJ `A
^\[5TEJ `A ^ [6J `A ^ [6J `A ^ [6ZK A ^\[6K PA ^ [7A pA ^ [7A A ^ [7A /A
^ [7A ?A ^ [7A A '^ [7A /A 4^ [7A ?A A^ [7A OA N^ [7A /A [^ [7A ?A i^ [7A A w^ [7A 0A ^ [8A pA ^ [8A p A ^ [8A A ^ [8A XV ^\[ `A ^\[ X V ^\[ ?A ^\[ @X V ^\[ A ^\[ @X/V ^\[ ^ ]
]] ],](]5]1]>]:]G]C]T]P]Y] b]j]t]j]}]]]]]]]]]]]]]]]]^^^^^^^^^^^!^(^/^6^=^D^M^V^_^h^^^^^^^!^(^/^6^=^q^^^D^^V^D^^^^^!^(^/^6^=^D^M^V^_^w^h^^^^^^!^(^/^6^=^D^^^^^^^^^^^!^(^/^6^=^D^V^^^^^^^^^^!^(^/^6^=^D^M^V^h^^^^^^^^!^(^/^6^=^^^^^^^^^^^^!^(^/^6^=^D^^^^V^_^w^^^^^!^(^/^6^=^q^ ^'^^^^^^.^5^<^(^/^6^=^ q^I^P^W^^^^^^^^^!^(^/^6^=^e^i^m^q^u^y^}^^^^^^^^^^q^^^^^^^^^^^!^(^/^6^=^@^@^@^@^@^ ^@^ ,^@B^ c^@t^ ^@^ ^@^ ^data_abort_handler badaddr_read @ ` ` ` ` ` ` ` ` pmap_map_chunk ERROR TIMEOU
DF \APbALAjATA cAeA \APbA8HAHAjAqR TSPeA ^^D^T^k^x^^^^2^D^T^k^x^^^^
^ ^ qAPCtCClAqApALAAAqRqRAqR TSPqR
# ( - 2 7 < F P
d ' Spectec SDIO WLAN Card SDW-820 d '
# ( - 2 7 < F P sdmmc_mem_enable ^ a ^ P ^ ^ , ^ @ P
/ HA ^ ^pxa2x0_i2c_intr_sub mBmB+^+^+^nBnBqRqRdxBqR oBSPoBqR 5 X[L[ 5 [[ = X[L[ = [[ V p[d[ V [[P1^U1^ [|[p1^g3^z] [[P [[t1^] ,[ [ [[%
8
@ ! ! @ ! ! # / ' ' w 0 g ' ' c 0 c ^2^g3^z] HT e2^q2^ z z2^2^ z 2^2^ 2^2^ ^2^2^ 2^2^ 2^2^ 2^2^ @ 2^2^ @ 3^3^ 3^3^ g3^A6^ P1^U1^ l ,3^g3^>3^ H R3^g3^z] [3^`3^ ^2^p3^3^ @ I e I I 3^3^ I 0 I 0E 2^3^ 3^3^ @& I I I 3^3^ 2^3^ @ " I 0 3^3^#3^ - / 3^3^ 3^3^ 3^4^ 3^%4^ 3^94^ 3^N4^ 3^d4^ |4^4^ 3^4^ 3^4^ 3^4^4^ " ) 4^4^ u E
o @ o
@ o @ ^2^5^ 5^5^ 5^ p1^g3^z] @& 3 B I @ "5^+5^ @ (# 0 X5^b5^ TB
5^ - 5^ ^5^ 2 ' E 6^6^6^ 6^06^ I6^Q6^ ^2^5^ \6^d6^ q6^d6^ ^2^6^ ^2^z6^ 4^6^ 6^6^ 6^6^ 7^
7^ V V w h 3^)7^ 3^=7^ R7^^7^ |4^s7^ |4^~7^ 7^6^ 7^7^ P 8 s o o P q q s M k l t 6^6^ t t 3 7^7^
h C 7^7^ h & FILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40
~ ~ d d d d d d d d0D `x DA dd@+d@Q d@P d@@`*b`d``(b(`d(`1@&`U` "*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D ` dȁ>c dY `Av `>c`a` f `dXY `c`a` f
`dXY XO. XO 0D d ceXOA `x `|c`da`F܄ ́ d ` eD @^
c`XNpx>D @^
c`XNpx /X .X 0D d@@C `exDĘ 0D ` `@` q`>exDĘ
`cexDĘ`d`Av?`d`ddD+ P`d`dЀ`d`#dЀ`dѺ`EdЀcG `C`d`vA < wD`W@J*D D@@/ @@ D`A` daD@@ @@dD? dDd`d`d`d?uD&& &
& @& `e` d$g`\` d`d@E+ @E `XOxXOJ fPeRaQ
@g&E@F`dP R~q&\` dٶ `e` d$g`\` d`d@E+ @E XO< XO fPeRaQ
@g&E@F`dP R~q&\` d %F&ADcՁ c `FB aDŁcEŁ`E dԄeD/X%DЀЀ ЀЀH %Fg/X` q ̃eD` u?ga#X@DDEDFDG? $D g $D? ` dDXCaC`E$D?' `
d`du? `(b`4d$E'= `dga@ D ߴ@@` f `d`AcXY `&d`AcXY d@Pced@Pg` f`c`dЀۃ D@@d@Pce d@P `x` dȁ>c dY `Av#X~`d$Ega#%E+ `pca$D' ӣԀ́$dXa d"%DZ g
ӾԀ́$dXga#XbCdC`A܄"ZbDɁX g a#X"bC̄ dAՀdCeAFdXɁ g a#X` d@KK`A"%D#fEHcȄ+FXeFɁ g a#X d@E` d@Fw`
/`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU` g a#Xw` `XNx`XN{x~`XNx ~`XNx`XN{x~`XNx/`b` aa\`XNx`G`E`XNx́Z`XNx`XNxU` g a#X`` .X`` .X c?@& σ.Xc`@* ` ` `?@& d d .Xc?@&܄ ` ` .X t
c7 ~ @AA Ł@
A ρ@
ʁ@ AA ہ@ ށ@ A ԁ@AA с@01A 3@2 6@754A <@=?>A:;A 9@8 (@)+*A./A -@,$%A '@& "@#! A`aA c@b f@gedA l@monAjkA i@h x@y{zA~A }@|tuA w@v r@sqpA P@QSRAVWA U@T\]A _@^ Z@[YXAHIA K@J N@OMLA D@EGFABCA A@@ c
< t
8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,.`_d`,d E`dG`d@ A B C D E
~
G ` d N` @99SA01000000 Primary F's F3.10-04 01/17/2002 ~ ~ &~ ~
~
~ ~ ~ FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54
~
`c܀ ` d `~d`d `#x`d$Ega#Xd@Pa "*2:BJRZbhpz ``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`x i h^ d@@ d@A@B@T@U@^@Z@[ `b`4dЀ `bU`dЀ `Pb`.d `RbƂ `Pb d `Rc d a`c `>a` f`dXY `c`~a` f`dXY J`c `a dY c `*c `@a`~dXY `a˃YYӤ `c` eEK`a` e`deFX+FY `c`Na`deFX+FY `c` a`deFX+FY i` d
`"b` eԀ ̄ eD eD̄|c`F܄Ѐ `F `F܄Ѐ d cD܄P3D `|a`XOxFE`XOx `bfD ed@* ``vc d ` e`cd`4b`~beD `0 `P `y````EĄ$`0d%`E)``d-1 `d&*`d.2 `d'+ `d/3 `d(, `d04$Ą57 d@Pc d@T@U@A@B@^ d@R`:e `@* & `b `zbdD> `\e`@ & `bdDL `bdDF d@A@F@G `c`d `fc dY `Av`_xu``*b`d``0`x 0D bcdefl@AC@I`x0D drD`Rd@@ ܀d@@H`@ : g`ed@ : dpmd@K d@M@G" d@L&D@Fe`@& : hh ddV`Tl@`DdFGg`\bdۜ d@&D@F'D" @Gd! d!=D@]D|@^=D @]`>D @^FG`d0D d@@@D@C@B@A`d@N<`jd@M`Vx0D ` d@@
d@K `ed d@\` x0D ` ` O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` g`d:\0` g`d:\:\@' ` ` ` 0` g`d;\;\@' g`d:\٘` d>@g`Lb d
d@H`d@Kg`Jb`d d@Li` q d@@`x0D (`edd d@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av ` |`dٮ0`x,E?A0D 4C)D" &: * Dt )D@I$A `eŔ A@d>D& Ad>D* b dg`Vb܄g`bd d@IrR2{MD )D@I e* `xd@; `_x`tDt@^E^@^ |`"bXO XO XO XO |XO XO
=D@]@]-`xe`Gc=D$@]4 @]`G`Ac=D$@]4 @]`G`Ac=D$@]4 @]d@& Dt@^|`FbƂXO `d`T2D+ D @^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN% dKt` x aFG`x>D@^F` }`>D @^FG&C*P CF*D# D d@@rE܄`UeR$܄'܄(*D܀X2@* ]`x-D &
&D@F6 ]'D* @G-DX67 d!& *$ @Gd! *D܀X'D* @G'D* @Gd! 'D* @Gd!`x&D* pDЀddP`xd"F)`dd d!`xdFG
d@L) : `d`E`dĄ܄? k>D @^=D@]>D@^=D@]d̄>Dw@^"c* c(D&
%D`Fa^+!F
(D6
cD|@^=D @]` }>D @^FG`xd `fFB` |E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@* fi hD `E|i hD `G e|i hD ЀdD`G%
6 676n6& |"5dW.DlC!~iÔg`^b܄d'D@G`xd@ 6 `x |@En65 76& 6
6 Z`d܄ڂ܄!c'D@G`t`xLH LH LHDžǃ DžメLHǃ'σ HCCLN |МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP* &D @F ЀlDąЀ a(D* @' alDąЀ2D*' (D6 : d8d`x@LlDlD a(D+ a`@@'ANlD(D6 6 6 `xa@"1 lD(D: Ha 6 (D: Ma IaAMFNd@L e-D*
-DI6 H: e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A & -D"2@* P@M d`d܄'D" @Gd!H'D@G .D$@AF p@MlD a(D+ a`@@+
`eC(D@H)d"#DAN &(@@'@C8lD#D+ d@C8#G?eEL!pEԀd`PlD.D"& #AlD4T lD.@ * lDlD.@& #AlD7? lD72D* bFEڂlDڂlD#Ax|eaCрFE7 dCс||; H #D Ѐ`C `xlDlD]>#A>||e%DՀaCE5 6 `x bрFEa@&a\ a dCсDZ # ՀaC7 bрFEDa@&a\ a dCDс Dz
lD |FE dlDZڷdA(D@+ 2D& lDD}@^d̄=D@] ` k=D@]>D@^(D@+> :D+ ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` dg`d:\0` ` }`>D @^FG/Xd? ;D@' @`@* `xA`@' d@* g`c ew + d@*
g`c0en @+ d@* g`cee ` `xd@* g`c UT`*e0/`AdC DaG D냓`eD`Ncǃe`@+ \aнPYЀYЀЀ eDT`Nc~e`@+ \aнPYЀYЀЀeD
=`LdăgD e""dD@[dG@[dD@[`G`AE 7 cBcd@:
cZ݁`Ea_@[eG݁a_@[ Z݁a_@[` ` d@: ` `3` d?8 (d@IFJd0D@Q`x@*F`@&e )C'D `A;@+ `Ww_Ɂ`Ww_% & c @J`F; =F8*F`@* c@& c `F+FJ `Ww_`G c@& c @JCIAG d0D@Q> |>=FDG`@& `x=F`edC`x`x`xL/~ =F>`x d0D@Q ` 0` ` d>>@:D;D=F` c`|`xwD`W@J*1 $D $F , @D`F`\` ddD:D& u ;D@[
-EԀ Z`pd܄ڂ܄*D* #D <`@d@GXOS FCfC`\`"ddD:D& u ;D@[*D"K "D `FF d@B@ <`Fd@GXO+ FB7"fC @* `$d:D& u$ ;D@[ * `$d:D& u ;D@[ 'B `F /X*D* !D `F<`pd@GXO FAfC`d:D& u ;D@[4@&;*D :D* ;D `U d@Z@[= d@J5@* $A @U,
GXO (FDf\` d:D& u ;D@[ 5@* #A @U`}x5@* "A @U`x5@& 4@* !A @U@T ?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`A d۾eC%D aD
aF%D %D'C`F fD.X(AXO .X(A@XO (AXO& XOV .X|c @E eeD܅ `F@E 3DT3D`|d d Ѐ/XfC%FaDg <~d d# acY /XL|aXO c,F%F,F %F dЀ
dFgXO .X'C %F %D
`F%D ܄/XLXO( GXO .XLXO GXO^ .XLXO G'D %C cF'C
fCdDX `F%D
.X%F @G
dC 'Bڂ$ ʂ `F cF(
%F d
'B̄/X%F # `F xgg%F d %DXO XO' .X'C %F %D `F%D
%F d
%D/X %D %F|d/X a %D `F fC ݁3EE3D/X%FЀdC`Fg d dFFEXO .X fFE)CfD%D dae<`cCI ́`Vx& Ԁ`EѽDGDHDE`dD3A @E`F`|dM3D d Ѐ/X
Xee
0DP@Q0D}@Q?* F\g`Xbd`.d@D0DA@Q?0D@Qg`Xb dB e`A #`E `A 6aDd@& d 89 89܄8dD$܄`\aD9da\Ad@& `@* g`c0 d@* `@* g`c' d@* `@* g`c F\"d `x`@* eG 6 `EąŅ=`NdăagD g`c ` ` 8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:a eG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z ` g`b*= d ` :\+ t@:\+ t@:\+ t@t@:\+1` ` :\' 1` ` :\+ dg`d:\0` :@@' g`\b dE` d@Z3` ?? `2xd8~ `G SQ`\ PQRS dT ) : SdD cc cUF\"`@&@ !`EELĄ!,D ) dd@:O ' Vc))`Gd@* . "bcL4L)`@:v `@ 6n !̄`A d́ SUdA6dE bá $Ƃ(ւ́(*Ƃ`C `e ddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ
dD 68 aEĄsEԀ.h`b` d
d@\"d` x& (E`@ : `dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nb dg`Zb `b* `dѕdA ) `@: q݁݁݁%`G`Ca@" #`XOJx `dݸ#`XOIx `d)`Eh`b``dh`beD"`dڎF\fD `x dhh`b`adF\`@* g`Xbd`id@D0DA@Q?0D@Qg`Xb dۙ:D+ P'
g`\b dE` d@Z3` `xL?~ )`@: Z`Zd܄ `e"d `x dD`A`G `EaD 脤 `AeGaE.XdD`A`G `EaD `AeGaE.X`G `E @M`G `A-D ́`EaG .X"`kx0D* G!XG?2D&W dEGS
2D&N ' `T `:d@B0D @Q?2D&6 dEG2
2D&- O :c >D@^@^ `dd@B0DD]@Q?2D& dEG
2D& !`;x `d@@ `d@A0D@Q?(``b g`bd"dڙ0DY@Q` d@@ `xg`bd"dڙ0DY@Q` d@@ `x!` d@@ `d@B0DD]@Q2D& d EG
2D& `e >D@^@^? 2D& dEG)
2D&$ g`bd"dڙ0DY@Q` d@@ `x `e ̄'% `x `ux (``b g`bd"dڙ0DY@Q` d@@ `x `x g`bd"dڙ0DY@Q` d@@ `x)`@@+% >`@& :\d@@' d@+ 3` `x:\d@+ & t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@& dh? d (``b d !*
!dN `e"``@& `@* ;D+ @' `x& g`bd `@* `x<`db `F d@ : pdg`bb d@>>=Fd@)@+ g`Xd F~ `CEeDF`@* #`xde k>Dp@^=D@]e `>c`"e dHdG `A`J׀h@g`b |`@* @eD @^$`x D @@d& dG?dD+ `HeD`J eI dh^`\`
d die@Q d D * 666 Dش@@ D@* $@@<`bڃ aۂZڃ aۂZڃ aۂZڃ a ۂZڃ a`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD %C CE D @@dCӽ@D+ `HdD `Jh@ dIhEԀ%C <`a c Y1Y c Y,Y c Y'Y c Y"Y c Y Y c YY c YY c YY c Y `x'`x'`xI`@6 6 6( : ZӜ۸ ` q ̄eD` usD `b
`b '`xf`b ̄:D@Z;n`G# ̄`G" dnh sAIՀ'pEą`XdĄ@M`AsEԀ
dD 60 aEĄsEԀ
g`|b d dh -DpEԀ
`P`Eh`b`1dh`beDdf`d ̄v`EwԀԀ(``bd d=`b ̄ =`c`dЄ2D*0 h`b;h`ā3 @@* d- dd`A D@@@$`daDd e
* `bЀ @@* g`|b ̄1/dA"D 1@* ^DB!DL!EԀXO ?<`4b `F@FH`bFg`rbd@7d@7 g a#X(`c d۽۽d## d"%D#$%&' g a#X"(`c $%۽۽d# g a#X8d8`G?(`G q 9+:,;-./0<1=2>3)R P<.Ѐ=/Ѐ>0Ѐ`AaDB= JCd@* (d@* d@& 8`\ dD`G@`G)9!9+:,;-123 1:2;3+,- /X d `eQd@* D c)s`d+c)d@@'CK!Vad@'ba8DM`@&" ÁрcE dCׅELӀe e c-D,E`AԄ߃aD)d`G),C -D
-D+Eāрd.X+L`@&9 +`AZ`AZ`AL:`XNx N
D @^
cXOv~ F =D@]
cXO> >Dw @^
cXO4 D`夅 @^ k`>D` `\`d٘ g#X<`bʂ"d;`x<`bd;`x<`bʂ d;`x<`bd;`xe e`Fce@* d;`x g#Xg`Pb g#X g#XCDw @^
cXOl m>D @^` k
cXO_ =D@]=D @]`\` dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M `CdD`L cFCO?`G`\e/FdC bڂɁ`L b`M /Xj` x `bр` d+ t` ` `b ` d dtu du `b `d
?Wg`b& eEHN `aAM@`XOx-A`XOxOd"` dZ(DZe<`b<`pdfDZ
dZ+ET;7Xa `FN `.aAM@`XOx-A`XOxO!a dX`.cd"` d#He dѽۥ́څ<`b<`pdfDZ
dZ+eET; 6E`dD d1D@Q `b ` d=`/x>`x`cӽѽѰ 1D@Q
|`
d>`x`Gā>`x1D@Q & `|b`@: ec `@: ec ce`@6e`lb `|b`@: ec `@: ec ce`@6eg`rb`Nb`A& e^a@& c^Z de`Dbd>`XNx & `c`xa`dXY `rc`@a`dXY `c` a dY `d<`bʂ d-
`d2@& `bӥ`A 6 ́`bNB`XO`xO=`/xfD W d@FNFE<`b dfDZ
dZ+`XOxO7X *4 `Db`E `b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb `Fb`G7: 6 6
`bF `d<`b dfDZ
dZ+ NFE<`b dfDZ
dZ+`XOxOY`d܄ڂ܄ۻ <`b<`FdfDZ
dZ+Y`d܄ڂ܄ۢ :=`/x `b ` d `e
a XOdX cZڅ ́ `b `e?`c dZրZZZ `e dZրZ /X `d@A `c dЀ áۣ `c dЀ
adD́ @BCD ACXO`X"D#A$C !C `e׀ѽ CA?`ddX@O)`@& @`.x`@6 `DdXOdD`" 12Ѐ Ѐ3ЀA`vx `eԀdЀ dЀ&F" g Ѐ&F"@g &F)`@ * \c`@+bcҽЀ\Ѐ҃XЀU d`XOZxA`Lx&F) &G cӀ`@: Z`d܄# : Z`d܄ 0: Z`d܄ : Z`d܄ : Z`d܄ `HdXO- `@:
h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO
@: Z`d܄ `JdXOA`rx: A`XN}x `RdXOZ`d܄ :n @@&2 )12ЀЀ3Ѐp܄p dq
`dnd@6P Z`d܄ `LdXO `NdXO= `PdXOA`rx`Bb) 1Ѐ2Ѐ3 Ѐp܄p dq
`dn Y` d`@" h`XNxN&Fg`XOxO&FV )=`e
dd@+h`b`0dA`XN}x^`EsDd@* Ԅ砖Z`d܄ `LdXO `NdXO f`b#A`XNx&Ff`bdۺ <`b<`jd&DZ
dZ+ d@F fD >`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ `b `dD`dZ/X `\(`~d<`b(`zddJ `b `dD`dZ/X `b d f`b܄ dd
e=`XN2x ` cd |̄g`ve`@"3 * `cf`e`EĄЀ%
g`ve`E D@@Y`d܄NR`XOxO `b` dE` dZ/X `b dD`IxdG dDJ `b d `b@` dE`-dZ/X<`b*Dʂ d- `b ` dE`SdZ/X `b d۾ `b@` ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dw d"8d(` dd)f`b`4erDf`c d۽ۣqpG`dӆf`cdds9`b d^h`b`df`cd(`c9`|e dGӀG`Dd[NR`XOxO `b` dE`dZ/X `b dY`d܄9`b K`XN+xF`x Y` bc`@ :n
af`b@` e c$́d(`~b<`b(`zddJ `b `dF`#dZ/X `b d dn9`b `Egf`b̄ۼY` b f`bs.dD :* eD &`bd@&`C(`~b<`b(`zddJ `b `dF`mdZ/X `b dE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&c a`E66 66eD̄`EaD a`E:`(ce@* d݁e@* d݁e@* d݁e@* d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeD e`@&e`@&e`@&eY`hbeD`c`cن d`dbvf`XN:x`b* d * d * d dw./0123f`cd dDJ `b d `b@` dG`bdZ/X<`b*Dʂ d- `b ` dG`dZ/X `b d۾ `b@` dddh`b`pd D& e=`XN2x D@@ `b `d `b `dG`dZ/X `b d=` ba c`EeD&߃́cD
=` b2db`@ 6 `b d=` b ̄=` b`be djkmod@& J`x `b `df`e" l^d `b`d `b` dH`0dZ/XI`x `b`dی `b`aZJۡZn`@&2 vd) c8" d!d `b d<`b<`.dfDZ
dZ+ `b `dH`rdZ/X `b`aZJۡZۆ /<`(b `F%@H d@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D `F
I`xdmI`x,D* (F+* <`b<`(dfDZdZ+<`(b `F+*1 K`XNx `b d<`b<`.dfDZ
dZ+ `b `dH`dZ/X `b`aZJۡZw"& dmdo<`(b `F@H `FI`xlЀ+w `Ck*c i`XNxji`XNxefDiK`XN
x `b d<`b<`.dfDZ
dZ+ `b `dI`RdZ/X `b`aZJۡZw"iFHi`XNx d! i`XNx#f`b܄ @H<`b<`LdfDZ
dZ+(D do i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ `b `dI`dZ/X `b dmm djdf`b < E@@f`d܄ی d* `b`d `b` dI`dZ/X `b`dی `b`aZJۡZE`xg`ve`@"= * `cf`e`EĄЀ&
g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO `b` dJ`JdZ/X `b d `Pbg`dqpddqf`b vDd* `b`d `b` dJ`dZ/X `b`dی `b`aZJۡZh`b`qdf`d d dpe=`XN2xf`e`ddC߃ЀHf`b d@|
e=`XN2x `PbV`Sd ` cd |̄E`x"f`b dpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)G c8" d!dd.X:`bC`A脐
aD dD * dG .XL`?xxQ`XN(xQ`XNxg)Q`XNxc8 d":`XNxfE a} dd@&dcY dYڧ(`~b<`b<`.d~ eDZ
dZ+d]<`b(`zddJ `b ` dK`dZ/X `b `d.<`b(`zddJ d] `b dZ&F8 `A L`0x}L`xe8ՀL`0xC &FQ`XN(x ~d(g@g)+..+,//,-00- d":`XNxfE adcYK`qx.&F>`XNx DL`xO`x `d d] `b dZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx `c'`da`cӽa`b `c`eӥЀ@GR`XNx `b dZf`e dD`x'C`XNx
`Fb`EՄ`E
e>`XNx g`bd `b d `b@` dL`wdZ/X'<`bʂ d- `b ` dL`dZ/X `b d۾ `b@` d D@@K`JxyQ`XN(x d)Q`XNxG b `dcaYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dM`$dZ/X `b `d!<`b(`zddJ c] `b dZ&F =&F>`XNxL`Yx `d<`b(`zddJ &F>`XNx d] `b dZL`x `d d] `b dZQ`XNxL`Yx `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY` d́X&F>`XNxddgde=`XN2xR`XNtx `b `d `b `d d] `b `dM`dZ/X `b `da`bd `@da`b d `dIa`b
d^ `b `d `b` dN` dZ/X `b dZ d] `ba`b `ba`bN`XN]xde=`XN2xf`ed`Xb dۥD`x ` d
c] `b dZ M`x/X<`b(`zddJ d] `b dZd.XdGF `e `cӣۧ(`~bٌ eԀ `b` dN`dZ/X `b dZ `c'`dd`Zb da`cӽa`b `c`edAЀI@GXՀ`Ea`b eD:d@*7 Հ4 a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x `b d `b@` dO`dZ/XFG `c<`bʂ d- `b ` dO`/dZ/X `b d۾ `b@` dd`Zb<`(b `F `b `dc `b `dM`x'C<ЀN`x'C@`A>`XNx
`Fb`EՄ`E
e>`XNx `b d `b@` dO`odZ/X'<`bʂ d- `b ` dO`dZ/X `b d۾ `b@` dyQ`XN(x ` d)Q`XNxQ`XNx aGddYځYYYP`XNxy-D8 d":`XNx<`b<`.dfDZ
dZ+d]<`b(`zddJ `b ` dP` dZ/X `b `d d] `b dZQ`XNxd`ZbdN`x `d<`b(`zddJ d] `b dZP`x `d"<`b(`zddJ d] `b dZ&F &F>`XNxN`x `b `dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc `b `d `b `dM`x D@@K`Jx])dA`@:
1 `b `d' :
" `b `d : e : e 0: e
`b `d f/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G ~`E ́.Xg`Hb* d * d * d d.X`ef`c'B>|Ԁa ae\f`baDf`b.X'B2 a c $: :
`@+ e׀c :
`@+ e׀c ,: `@'c Y`hbY`jc`@* cd * cd * cd cdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``b d.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed ́a`c&F123.X'D`AC腔&& * `@* a\Ga`b P'Aa`cӽYЀYЀЀ d d .Xf`c ddۣg` c ddۣ'D'DЁ af`caDۣf`bс af`baD.XY`bf`*c d۽۽۽g`b d.X d]<`c!D d `b dZ `*c `@a`~dXY /X `b `d/Xz./0 `bg`cӣ e~ g`bd|d
(|`E-d`dxd `b d D& d'`d
@* `bӱ=`Lb deDq @@&n ` ez@~)`d[ `Ce @& |dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @& dD,A `G ~`E ́z-D8f`bf`b `Zcq\`G `VbeA`EaDԀԄ `E `TbĄ@J `Xb d `ddT`xdR`~ x `Xb `Zb *D܄d *D̄d@J `c @@& dD6 : `6c*DG `b d `b@` dS`dZ/X<`b*Dʂ d- `b ` dS`dZ/X `b@` d
dW D@* `b `d D@" T`rxz{ d":`XNx<`b<`.dfDZ
dZ+ `b dۯ(`fb<`b(`bddJ `b `dT`%dZ/X `b `d <`b(`bddJ g`b(``bd dS`|x `b d۱(`fb<`b(`bddJ `b `dT`fdZ/X `b dW .S`|x `b d۱(`fb<`b(`bddJ `b `dT`dZ/X `b dS`|xR`x(`fbٲ(`rb<`b(`bddJ <`b(`nddJ `b ` dT`dZ/X `b `d<`b(`nddJ S`|x `dW
d <`b(`bddJ S`|xW<`b(`nddJ `bg`cӣЅg`bԀeD g`bAd `bf`c Y`d܄ `b d `b@` dU`$dZ/X~<`bʂ d- `b ` dU`JdZ/X `b@` d D" e=`XN2xV`x ``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG
eЁG aaD,BZZD (BJJBHD (D'`cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB `Cf`be eELDH(E׀6Z>`Edԅ,DdGcBeF(Eր bF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@ `b` d `b dZ/X<`b(`bddJ `b dZ/X `b `d/X `b `d/X @& ``c`d# =`Lc `EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dD dG 123`|8 D
`Bb`@: d@*; W`XNYx`dЀ2- 6 f`d `C X`XNx`deDЀ`>`CaD`dЀf`b dۇeă ddG`E ;F ܄dX́d@Mae@*dD -ZdG -́Z2cÃae@&Y Ȳ dYYYЀ2eă a`@" * `@: $ : : 6 `XNx `Va ` c `Tba ē dD|̄ eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx` dԀ9cD" `G eԀ*X`XNxe\X`XNxgAX`XNx-D EMX`XNxeAX`XNxf`beDX`XNxf`beD-E `|dA ef`b@N.Xf`b.Df`bZZ `C6ZdE`A cD" `G `\cD" `G `EdDɁՁaDǃ ߃X`XNx`dԀX`XNx ef`b@N.XcD" `G `EcD" `G `G.X/X `b `d/X(`b<`b(`ddJ `b ` dX`dZ/X `b `d Gg`Bbo` dXO) O `b`aZJۡZ`zb* Gg`Bbf` dXO g`Bbi` dXO O HNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:Y P[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&A g(F d d .+/,0-./0Cd@* `G@`G) c(":`XNx ~<`b<`(dfDZ
dZ+ d@FHo`_x+gDЀ8{ܠ x`e Ԁ` dpЀg`clg`
d܄Ѐ`Ѐ ]\` d c a&eҡСdDՀف&FC`Gd@&@`G) ~(d8 d"(+,-./0 `E&F3dD2eD1:`XNx<`b<`(dfDZ
dZ+g` d܄o`x&Fk`x `dfE FK FI0eF0/Ѐ)F/.ЀeF.Ѐ)F.X d h`b)`@ 64 : dD eԀ/+ dD DdD6& 6' 6( 6) @6* 6+ 6, 6- 6( 06) P6' 6( 6 6$ 6" h`bh`c dۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`c dۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`c daѥрp`xh`eh`c daѣрp`xh`bh`c dۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8( `DbdGЀ `Ac `Fd`EХЀeD́d@' H РdD `EdD Ԁ*Fp`xh`bh`c dۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`c dۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOx h`bdp`xh`bh`c dۣ)+: +Ѐ,Ѐ-Ѐ@h`bBh`b @G Veh`aeCPҡЀҡЀҡЀ 'D̄@G)' .Ѐ/Ѐ0Ѐ\es`XOx +& h`bdp`xh`bh`c dۣ8FJ`Ah`b6 h`b6 aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b @G"\eh`aeCPҡЀҡЀҡЀ'D̄@G
h`b: s`x8 s`xh`b6 `DbdG <9c`A`FdР́d@+* Р' `DbdGЀl`Ac `Fd`EХЀeD_́d@+
РdD `EdD ԀMe ~`GāaE& ~ `G ā& `G Ѐ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`b h`b@Gh`aeCPҡЀҡЀҡЀ'D̄@G H/X`*b`d`` c` f `{d̄`*b`d` `x ! Secondary F's ~ 8
$
F @ p 4 '' d d ' /
d
# + `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@ `xA `x %`-xC `x $`xE %`ux `x =`%x?`Gx y=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo
h0313DD031303132323 x==3F446 45" 45 46" 45 45 45" 45 4~7
45 45
45 45^ 45p 45 45: 45D 45F 45 407 44f 45j 45 45vg 45 499
45 45 45a !4 5a $57 %57 &57 '57 #45 (77 *45 +44x ,48f -48 .45f :45g )5<5^X 45 45 45 407 4 7 Y 45| 45z 454 45 45 4-8~ 47t 4r7 45 45 /45 04K8 148 44J 64L 64Z A64 448 44$ 44` 44\ 44v 44r 44> $44 %44 &64t '648 E44 G44N H64l I64n J44 K44 M64\ P44Y O64X 64` 44 64 64b 44
h64: !h64B
"h64
#h640
@44 A44 Y" B45 C64 D64 F44 L44 44 44 44f 64d 64f * 555 96^m Y0$\$Y$z#\$\$ b$b$b$ $%{# w$ HH
\ "t$&
(* , . 0 246z8
:$<> @ B D F&H[JL)NP R TVXZ\ ^`b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. 8
\ "T$&j(* , . 0 246z8:$<> @ B DFHJL
NP R TVX Z\^&`[b , .,.,.,., ., .,$.,(.,.. ,4.
,8. ,<. ,?.
,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,. ,. ,. ,. ,. e g \ 2 e ~ Z ~ n * > R f z " 6 J z ;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z [>
[>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZ hYjY,28DJhn̘ a a ` $ P[ <_x bd a *g8 Y g 4UY Y Y Y Z Z Z BZ ZZ pZ tZ xZ |Z Z Z Z Z Z Y Y >g Y Y Y Y Y Y Y Y Y Y lY FY >g 8 Y Y Z Z Z Z Z Z f~ @
$ L~
F @ P X~ Z~ &~
8
č ~ ! ZנB>>>ffffHHHHaaaa5555WWWW iiiiَ UUUU((((ߌ
BBBBhhhhAAAA----TTTTPQSeA~ä^':k;E XKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk +XhHpElޔ{R#sKrW *Uf(µ/{ņ7(0#j\+ ϊyiNeվ b4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG
|B| H+2p NrZlV8 ծ='9-6d
!\hT[:.6$g
WҖO aiKwZ
*C"<
Nj-ȩ WLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/ 0R
wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:,
xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL ,QeF^]5st.A Z gRے3VGmaךz 7Y<'5a h,4$8_@r %⼋I<(A
q9 ؐVda{p2t\lHBWQP~SeAä:^';k EXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk +pXhHElR{#srKW f*U(/µ{ӥ70(#j\+ ϧyNieվ b4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG
||B 2H+ plNrZV8= ծ6'9-
dh!\T[$:.6 g
WҖOa ZiKw
*h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk +hHpXElޔ{Rs#Kr WUf*(µ/{ņ7ӥ(0#j\ ϊ+yiNe;b4 ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y
|GB| +2Hp rZlN8Vծ= 9-6'
d\h!T[.6$:g
WґO aKwZi
*"4$8,@_ r% I<(
A9q Vd{a2p\lHtWBQPA~Seä':^;k EXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk +HpXhEޔl{Rs#Kr WUf*(/ņ{7ӥ(0#j\ϊ+ yiNeվ4 bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G
B| +2H pZlNrV8= -6'9
d\h![T6$:.
gWҖOa wZiK
*"$8,4_@ r %<(I
A9q Vd{a2plHt\BWccƄ||ww{{
kkֱooTőP00`gg}++Vb櫫MvvEʏ @ɉ}}YYGG 쭭AgԳ_E#Srr[·u ᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07
/ 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ ,` @ ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa
ppB>>|ĵqffHH aa_55jWWйiX' :'8볘+3"iip٩3-" < I·UUx((PzߥY
ڿe1BBhhAA)w--Z ˰{TTֻm:,ƥcc||ww{{
ֽkkޱooT`P00ΩggV}++bM櫫vvE @}}YYGG A쭭g_E#Srr[u· =Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7
/ $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh ,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88cwuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y^^ v;dV22tN::
II
Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$ WsǴQ#|tt>! KKaܽ
pp|B>>qĵ̪ffHH £aaj_55WWiйX:' '8+"3һiip3-<" IΪUUPx((zY
eڿ1BBиhhAA)Zw-- {˰TTmֻ,:ccƥ||ww{{
kkֽooޱőT00`PggΩ++V}bMvvʏE ɉ@}}YYGG AԳg_Eꜜ#Srr[u =&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7
/ $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh , @` y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋
pp>>|Bqff̪HH aa£55j_WWiІX :''8+"3iiһ٩p3- <" ·IUU((PxߥzY
e1BBhhиAAÙ)--Zw {TTm,:cƥc||ww{{
kֽkoޱoőT0`P0gΩg+V}+bMvvʏEʂ ɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u· =&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7
/ $6=&'Ni'Ͳuu ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh , @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP! KKaܽ
pp>|B>qĵf̪fHH a£a5j_5WWiйX :' '8+"3iһi٩pَ3- <" ·IUU(Px(ߥzߌY
eڿ1BBhиhAA)-Zw- {˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث
XXXXEEEE,,,, ????kkkk::::AAAAOOOOggggꗗsssstttt""""筭55557777 uuuunnnnGGGGqqqq ))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZ ݨ33331111YYYY''''____````QQQQJJJJ
----zzzzɜ;;;;MMMM****뻻<<<5tv0e F9pJ4)N~_I<@;ruf8) ^(P <`*K O4=I|`U{V;Q x]] ]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d
qո=Hጟ\̤~|f!&
;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq $c (N~czt;6DɆ'@ZzF|3 @ 0bS:FȲc\Tn~ .3h8}ȉ0Ͳt6ѽH 8]0] DtxnuU Q]lRϰqbiǓ4'g_Bj ȝ|na
vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq
f@ZsyTH 8]0]DtxnuU Q]lRϰqbiǓ4'g_Bj ȝ|na
vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw 'iR_ A0qYHuhhOިXr^>34
z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^ q_eNN L4ʧ= 1@dO*T%SRQt@ 8]]DtxnuU Q]lRϰqbiǓ4'g_Bj ȝ|na
vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM } uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_r /_@[ ,Κ;q Lr!oADSgEmV1JBچ8{ B ieee80211_setmode @ P ,
$
0 H ` l
$
0 H ` l ieee80211_media_status , $ 0 H ` l ieee80211_media_change $0H`l $0H`l _ieee80211_crypto_delkey ieee80211_crypto_register ieee80211_crypto_unregister ieee80211_crypto_newkey OI^XI^bI^oI^yI^ieee80211_crypto_setkey ieee80211_crypto_encap ieee80211_crypto_decap ccmp_setkey GJ^
D
Dd
D( DDdDXDieee80211_hdrsize J^ lDpDtDDD|DDƄ
ֱTP`}VbME @Ɏ Ag_E#S[u =jLZlA~O\hQ4sSb?* ReF^(07
/ 6$=&iN tX.4-6[Mva}{R>q^h ,`@ yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(y v;VdNt ے
lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa
B|qؐ _jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ {m:, 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkey tkip_decap cK^ D D DL D DL'D`&Dieee80211_hdrsize tkip_encap 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z-K^ -D-D'D.D|*D/D'Dieee80211_hdrsize ieee80211_hdrsize ieee80211_sysctl_treetop ieee80211_sysctl_setup ieee80211_sysctl_attach ieee80211_load_module _ieee80211_free_node node_reclaim ieee80211_free_allnodes_locked ieee80211_node_table_cleanup ieee80211_reset_scan _ieee80211_find_node ieee80211_setup_node ieee80211_cancel_scan ieee80211_get_rate ieee80211_tmp_node ieee80211_find_rxnode_withkey ieee80211_find_txnode ieee80211_find_node_with_channel ieee80211_find_node_with_ssid ieee80211_free_node ieee80211_create_ibss ieee80211_ibss_merge ieee80211_end_scan ieee80211_next_scan ieee80211_node_delucastkey ieee80211_iterate_nodes ieee80211_node_leave_11g ieee80211_timeout_stations ieee80211_node_join_11g ieee80211_node_table_reset ieee80211_node_lateattach ieee80211_node_table_init P ieee80211_encap ieee80211_mbuf_adjust ieee80211_compute_duration P P P P P P P P ieee80211_send_probereq ieee80211_send_mgmt ieee80211_mgmt_output ieee80211_beacon_alloc ieee80211_beacon_update !g^ !g^!g^!g^/g^!g^/g^ieee80211_newstate 0 0 0
@
@
@
@
@
@
@ ieee80211_wme_updateparams_locked
^ ^ ^ ^ ^ ^ ^ ^ ^ ^ / / f / f / / / / f / f / /
ieee80211_wme_initparams ieee80211_rssadapt_sysctl_setup i^ ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ %% $ $
$
$ $%% %%<%## %## %$%4%,%%d"e"`"
" %" #!#%#
# # #
"" *# d"`"e"+"4" " " ""<"C" !!a" """)"*"'"(" " !!!! ^^^^^^^^^Ɯ^̜^Ҝ^^ޜ^^
^^^^^^^^^X^\^`^d^h^l^p^t^x^|^wsevent_copyout_events xJJJJJqR4JqR JSXJqR ABCDEFGHIJKLMNOPQRSTUVWXYZ J̯J4JqRJqR JSJqR @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ???????? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? ? ? ? ? @ ` p x | ~ 0 8 < > ? ? ? ? ? @ `P0pH(hX8xD$dT4t L,l \<|B"bR2r
J*jZ:zF&fV6vN.n ^>~A!aQ1q I)iY9yE%eU5u
M-m ]=}C#cS3s K+k[;{G'gW7wO/o _?H & x & ਁ & `]] X]] o `_] _]
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ a] a] a a] ) b] 2 =b] ob] pb] ͳ ɿپ ̴ ް
!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ PX lJK TF 4J(J PN tJ RR J CE ,J ST J NM K(K CL J 0 PL J 0 RE J @ RR J CE ,J ST J SL K RR J CE ,J ST J ER K CE ,J ST J X ,h]f]de] / K^ dle]p]Vġ],W],W],W],W4],WP]%Kl]"K] K],W],Wܢ],W],W0]8X],WL],Wh],W],W],W],Wأ],W],W],W,],WH],Wd],W],W],W],WԤ],W]J ]J(]XD], X`],W|],W]l%K]L XХ],W],W]V@],W hf]p]Vġ]\.X]LX]LX]H0X4] ;XP]%Kl]"K] K] 4X]5Xܢ]tX]8X0]8X]\/XL]8Xh]9X]XX]9X]9Xأ]dX]LX]LX,]LXH]LXd]LX]LX]LX]LXԤ]LX]J ]J(]XD], X`].X|]T:X]l%K]L XХ].X]=X]V$]W@]X l4h]p]Vġ]J]tX]tX]dX4]dXP]%Kl]"K] K] K]tXܢ]tX]tX0]8X]PXL] X]XX] X]dXأ]X]tX]X$K,]tXH]tXd]tX]x$K](K] !KԤ]0X]J ]J(]XD], X`] J|]$K]l%K]L XХ]@&K]lX]V$]W@]X ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????
!"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ! #$%&'() + - 0123456789 @ABCDEFGHIJKLMNOPQRSTUVWXYZ ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{ }~ ϾǎԐѥ噞᷵ǎԐѥ:K:K Xt:K0X|:Kupdatefats U m] / |sKm^ . .. $m]p]Vġ][K]\K]tX]dX4]|KP]Kl]K]K]K]Kܢ]tX]tX0]8X]PXL] Xh]4 X]XX] X]ܧKأ]X]K]tX,]TKH]Kd]|K]tX]lK]lXԤ]0X]DK ]DCK(]XD], X`]\K|]DK]XK]L XХ]K]ܘK]V$]W@]X A a B b C c D d E e F f G g H h I i J j K k L l M m N n O o P p Q q R r S s T t U u V v W w X x Y y Z z
!"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx yz{|}~s STVWY[`cihoru
"#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|} PQRSTUVWX Y
Z [ \
]^_0123456789:; < = > ? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~
1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV --------- -
- - -
--------------- - - - - -!-"-#-$-%-
! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~ a
( ) ! * " + # , $ - % . & / ' 8 0 9 1 : 2 ; 3 < 4 = 5 > 6 ? 7 H @ I A J B K C L D M E Y Q [ S ] U _ W h ` i a j b k c l d m e n f o g p q r s t u v w z { x y | } &!*!k +! 2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ ,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9,
,:, ,;, ,<,
,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K, ,L, ,M, ,N, ,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,} d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z \ LhL \ Ll
Lnfs_sillyworker h
L
L L @ `]T]:]&]]]]]]]]h]R]4] ]~]~]~]~]~]~]~]
?BEF
F '' F F '' F F '' F ''
F '''''
F ''''
? E F '''
? B E F '''
? B F '''
? F ''
? E F ''''
? E F '''
? E F '''
? E F '''
E F '''
F '''
F ''' F ''
? F ''
E F ''' F ''
]]$] / x^L _ T,]p]Vġ],W],W],W],W4]LP]Ll]PyL]LL]dL]Lܢ],W],W0]8X],WL],Wh],W],W],W]}Mأ],W],W],W,],WH],Wd],W],W],W],WԤ],W]L ]L(]XD]L`],W|]LX]L]L XХ],W],W]LX@],W X]p]Vġ]\.X]LX]LX]H0X4]8LP]Ll]PyL]LL]L] Lܢ]tX]8X0]8X]\/XL]8Xh]9X]XX]9X]9Xأ]dX]LX]LX,]LXH]LXd]LX]LX]LX]LXԤ]LX]L ]L(]XD]L`].X|]T:X]L]L XХ].X]=X]V$]W@]X \]p]Vġ]pL]P-M],M]xL4](}MP]Ll]PyL]LL]L]ȵKܢ]tX]tX0]8X]PXL] Xh] L]XX] X]}Mأ]X],sM]L,]tMH][Md]L]0EM]L]LԤ]0X]L ]L(]XD]L`]8xL|]L]L]L XХ]TL]L]LX$] K@]X ffs_mapsearch ffs_nodealloccg ffs_blkfree_common ffs_freefile_common ffs_blkalloc ffs_blkfree ffs_realloccg ffs_blkfree_snap ffs_freefile ffs_freefile_snap ]] ] ]
@ !
!@ *&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ > ~ ? SNN0XԯNffs_newvnode ffs_reload MMMlMMlINMN ffs_sync ]t]] / N^ t]p]Vġ],W],W],W],W4]NP] Nl]N]0N]XN]Nܢ],W],W],W0]8XL],Wh],W],W],W],QNأ],W],W],W,],WH],Wd],W],W],W],WԤ],W]kN ]XHN(]XD], X`],W|],W]N]L XХ],W],W]V@],W]LIN\]TINx]\IN]dIN]DIN̦]?N x|]p]Vġ]\.X]LX]LX]H0X4]NP] Nl]N]0N]hN]Nܢ]tX]8X]\/X0]8XL]8Xh]9X]XX]9X]HNأ]dX]LX]LX,]LXH]LXd]LX]LX]LX]LXԤ]LX]kN ]XHN(]XD], X`].X|]T:X]N]L XХ].X]=X]V$]W@]X]LIN\]TINx]\IN]dIN]DIN̦]?N |]p]Vġ]lrN]ĒN]N](N]N4]ؓNP] Nl]N]0N]8LN]ANܢ]tX]tX]PX0]8XL] Xh]4 X]XX] X],QNأ]X]@N]N,]NH]ПNd]$N]N]ԤN]NԤ]0X]kN ]XHN(]XD], X`]gN|]ШN]N]L XХ]0N]ԭN]V$]W@]X]LIN\]TINx]\IN]dIN]DIN̦]?N ȍ] / VN^^Ѝ]p]Vġ]LX]LX]LX][N4]\^NP]LXl]LX]LX]LX]LXܢ]tX]tX]PXL]LX]XX]LX]9Xأ]LX]LX]LX,]LXH]LXd]LX]LX]LX]LXԤ]LX][N ]X\N(] XD] X`]H[N|]P]N][N] XХ]LX]LX]V@] X ufs_inactive ufs_dircompact ufs_dirgrow ЃNNtNN N$NNNdN N . .. hNN `N^D^J^^^^^^^^
@ ` ^ _^m^^ _ _ _
vcache_reclaim vrelel holdrelel vcache_make_anon vwakeup WWWXWPWОWW0WPW _ h] _ `] _ X] _ P] _ H] _ @] _ 8] _ 0] _ (]
_ ] _ ] _ ]
}_ ] s_ ] i_ ] `_ ] S_ ] H_ ] ?_ ب] 5_ Ш] ,_ Ȩ] !_ ] _ ]
_ ] _ ] _ ] _ ] _ x] _ p] _ h] _ `] _ X]! _ P]" _ H]# _ @] $ _ 8]% {_ 0]& n_ (]' a_ ]( U_ ]) H_ ] * ;_ ]+ ._ ], _ ] - _ ] . _ ] / _ ] 0 _ ا] 1 _ Ч] p]]ġ]]]]4]P]l]]]]ܢ]]]0]L]h]]]]أ]]],]H]d]]]]Ԥ]] ](]D]`]|]]]Х]]]$]@]\]x]]]̦]] ^ ] x]p]$W]dXġ]W]W4]dX]W] Wܢ]tX]tX0]dX]WL]W]W]W,]$Wd]W]dXأ]dX]W ]dX(]tXD]X`],W|]W]W]L X]dX$]W@]W xWW WW|]p]Vġ]4W]LX]LX]PW4];m^2I чHQ^|nQn - q+Q^ZI чH^|nQn - q+^ SFU 0eC^I чH
_I чHt_- чH
_- чH
_ SFH 0eC쬁 _XXXxXXqR TSPqR XXĊXXqRXqR rRrRXXXqR TXPqR (XqRqRqRqRqR TSPqR XXXpPX$XؗXXP ȞX`XXqRqRqRqRqR TSPqR XxXXXpPXXXXP _bpf_mtap_softint_init / ЬX: _ _/ X _ ifaddrpref_ioctl d n;0&AvQkkXaM * C = D $ E = F $ c d e @B `S ا @B O [ @T 6n Q% l 7 J rt_init rt_timer_init mZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdr x x route_output rt_msg1 route_enqueue rt_newaddrmsg qY@sYY]xY DYYY(YġYY0YȢYYY8Y@YtYDYHYPY0YXYYarpannounce arp_dad_start arp_dad_timer arp_rtrequest arpresolve d YY hYin4_cksum wqinput_create wqinput_sysctl_setup / ZH_ / Z_ / Z'_ / Z__ V P X X X HY qU J X]] ^]^ ]Γ^]Y^]^] ^]B^ع]Ǖ^й]'^ȹ]^]<^]^]^]^]]]X^]_]_|]^t]w_l]^d]|]\]^T]%]L] ^D]!^<]`!^4]!^,]z%^$]&^ ]_]'^ ]_]_]]]v]]]]]ܸ]]Ը]+^̸] ]ĸ]6^] \ d , ā L Ԏ t Ђ 䡁 H Ġ l @ 蟁 d 8 ^ ^__^ ^^e^_6^6^X'^_v]v] _]_]] ] N]_|]|]!^!^&&&&l&L&,& &%%%%l%L%,% %$$$$l$L$,$ $####l#L#,# #""""l"L"," "!!!! \] t] ؽ] ] L] ] ] ] ] `] ] ] ]p] H] ] ̼] (] _ ^ _S^X] ^S^y]S^e^ _S^6^ .^S^B^ N] _ ^S^_^ _ ^ ^S^^ X'^ _S^^S^!^ ^S^y] _ =^S^_S^v] ^ ] |] _S^y] _ _S^_S^_S^ _S^_ ^S^_^ NBCDB
@ @ Z g g }
j (sF K #( % strtoumax strtoimax 0w,aQ mjp5c飕d2y җ+L |~- d jHqA}mQDžӃVlkdzbeO\lcc=
n;^iLA`rqgjm
Zjz '
}Dңh i]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+
L
J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е, [d&c윣ju
m ?6grW Jz+{8 Ғ
|! ӆBhn [&wowGZpj;f\ eibkaElx
TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0 º0S$6к)WTg#.zfJah]+o*7 Z- A1b62S-+ldEw}ZVǖAOIъ OM~- QJ#SpxAaU.7 Y -6]]w ll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* , m8 6F߲]qTp0ek*1u 4yީ%8 S1bSWĔՖ k1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$ ,52F* sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL 8^#ܖ TZ1ObbSyOIV~P-{ b-R4 ٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ
?&~?$pi;FBzw[keZ~7 Sv8H 3?r$ 7jnԄYFܨ |OQ;օ
U d S
-
=G\ p& G w ) ` /a߫i5&LsZ<#0zMzFM8,9; :R:( q-v,.7/pXqY s3r %w+OQvrtEux܉~OK
}!b|ty Bxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HIN SKyuJcO NZLݘMFGN@E$DD2AsX@*IB CPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^
iϏ은BI#ƈdX ܁T̓cQ:
rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"_HS1 ^Z4 eg Wb27_k%8ם(ŊO}doJj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg;
i8P/ _Y=чe:ZO?(3wwXR
@hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?# 1jvʬ`p^ Y<L~i/{kHwâ
hs)aLoD~Pf7VM'(@ﰤ ہg9x+ n&;f?/X)T`D1 ߨM ߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$ !AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3
m:@/)IJNv"2x+ ٗ Kx.HҥfAj ^y9*O]#kM`~b_R 7zF h!1߈Vc0a"j6nS Nr )Υ{t*F8#vufz`rs"WG9^EMvc&DAdQy/4 Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫϩ7~8A]&nv|o Y
yKiw\¹9~$ 66nQ fq>,o,IӔ 渱{I
.H>C-Yn馑gQ z taf w0a, Qmpjc5dۈ2yܸ و L+~|- dj qHA}mԵQӅlVdkbze\Ocl=c
;n Li^`Agqr<KG
k5Blۻ֬@2lE\u
ϫ=Y&0Q :Qa!V#Ϻ(_ ٲ $/o|XhLa f-=vAq *q 3xɢ 4 j
m=-dlc\kkQ labe0b Nl{WeP|b -I|LeMaX:QΣ tԻ0JߥA=ؕפmCij4ngF`D-s3
L_
|Pq<'A Wh% of a^)ɘИ"רY=.
\;l tҚG9w&sc d;
mj>zjZ
'}D hibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K
+گ
L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮ d°c&ujm
6?rg WJz{+ 8Ҏվ
| !Bhݳ ڃn&[owGwZjpf; \ebiaklE
x
NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮SG0齽 ʺS0$6TW)#gfz.aJ]h*o+ 7 Z- 1A26b+-Sdl}wEVZOAي»IˬO ~M- JQS#xpaA.U7 Y -۩6˚w]]ll A?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z , 8mF6]pTqke0*1¶ u4%y<8syjHA}X* ݹ 1SbSW§ٖծ 1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8, $5 *F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8 #^T O1ZbbySIOP~V{-b -4R ^~GelHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb#
&??~p$iBF;[wzek~ZS 7H8v ?3$r j7nFY |OQ;
U dؓS
-
\G= &p G w ` )/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+ )`F(>
q-q ,v.Ț/7pqXs Yr3w% vQO+tru՛E~xKO}
|b!ytxB z{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKS NJuyOcN LZMݥFĚGE@ND$A2D@XsBI*C ThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z
&J8 좞V`a/6i\lU,zB\u H=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_
^ϋiBۉI#dX фTQc:r
Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފ Z^ھ4 ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[
;g /P8i_ Y=嗇e:ϏOZw3(?RXw@
Qh+HZ"0*WOIo@}m5N#+'*GA |HX=#?X1 vjʨ`^p YL'! $UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n
:m@I)/NJ2"v+x xKH.jAf^ O*9y]#Mk~`bю_ Rz7h Fм!10cV"ajحn6 S rN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA 4S&ֿ EbLil!>aDƋΪ~7A8n&]|vY oᡱ
Kyiw¡\~9$66 Qnf>q,o,ӹI 散
I{. C>HnY-Qg̰ t zfag jgrn<:ORQhك [/BD7q۵[V9Y?^ [1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg))
'8!.m,M
8STs
e
jv.,r迢KfpK£Ql$օ5pjl7 LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6 _:OтRQ l>+hkAك y!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^ BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= %
GoQcpn
g))/F
'&&\8!.*Zm,M߳
8ScTs
ew<
jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7 LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj( c#齂lPyƲ+SrxqƜa&>'!Ǹ }xnO}orgȢ}c
?G 5 q}#w($@{2
˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd
. ۤO HG __subvsi3 __subvdi3 __negvsi2 __negvdi2 __mulvsi3 __mulvdi3 __addvsi3 __addvdi3 __absvsi2 __absvdi2 _Q^ _ _| _ _ _^m^
_ _ _^^ _ _ _ _ _t_
_ _n^ _ _ _ _ _
_ _@^ gntsZ |ZZ h 7 _
o^ E[~ _ 7[ _ 7[e^ 4[] ,[ _ <[0 _ [ [[ rbmn[ [ [ [ [p( _tcid [[ [L+[$[[[[[ yekd[ [[ ` _Hă _XÃ< _h, _atad.[ H.[-[ ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ 8Ń _loob$6[ 6[6[ yarax:[@8[<[X9[09[ @ƃ _strtoull strtoll strtoul Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005,
2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017,
2018, 2019, 2020 The NetBSD Foundation, Inc. All rights reserved.
Copyright (c) 1982, 1986, 1989, 1991, 1993
The Regents of the University of California. All rights reserved.
INSTALL_C700 NetBSD 8.2 (INSTALL_C700) #0: Tue Mar 31 05:08:40 UTC 2020
mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700
@(#)NetBSD 8.2 (INSTALL_C700) #0: Tue Mar 31 05:08:40 UTC 2020
mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700
8.2 NetBSD md%d: internal %s image area
match_bootdisk: can't get label for dev %s (%d)
no mainbus found wd WARNING: double match for boot device (%s, %s)
boot device: %s
The operating system has halted.
Please press any key to reboot.
rebooting...
REBOOT FAILED!!!
ffuart btuart stuart glass cpu not recognized! initarm: out of memory initarm: Failed to align the kernel page directory dos partition I/O error mbr partition exceeds disk size CD001 BEA01 NSR0 disk label read failed disk label corrupted disk label write failed iso partition bad sector table I/O error bad sector table corrupted : I2C controller
unable to attach PXA I2C controller
i2cbus pxaiic : PCMCIA/GPIO controller
%s: invalid CF slot %d %s: failed to map memory %x for scoop scoop_pcic_read: bogus register scoop_pcic_set_power: bogus power state scoop_pcic_write: bogus register pxapcic_scoop %s: not configured.
can't map bus space
couldn't establish power handler
zssp %s: not configured
zssp: zssp_ic_send: invalid IC %d
Sharp Zaurus frame buffer Sharp Zaurus LCD w100lcd std : ATI Imageon100 LCD controller
failed to map config (errorno=%d)
failed to map register (errorno=%d)
failed to vram register (errorno=%d)
unable to create new screen (errno=%d) lcdctl %s: this kernel is not support SL-C1000
couldn't register event handler
zkbd : pseudo power management module
apmdevif zapm unable to establish nSD_DETECT interrupt
unable to attach MMC controller
%s: zmci_set_power(): unsupported OCR (%#x)
zmci vfp fpscr traps cnopen: no console device cnopen: cn_tab->cn_dev == dev cnopen: unable to get vnode reference
base 0x%x -0x%x irq %d drq 0x%08x core %d mainbus_bs_alloc(): Help! mainbus_bs_free(): Help! cpu_mainbus lr , rrx , %s r%d , %s #%d thumb insn
%s%s , #%d #%d ; #0x%x [r%d] [r%d #0x%03x #%s0x%02x %sr%d { r%d-r%d } ^ f%d .%c%d , #0x%04x spsr cpsr p%d f%d, c%d, c%d, c%d, c%d r%d, c%d, c%d, %d %d, r%d, r%d, c%d [%c - unknown] und%s %08x
oshst osh nshst nsh ishst ish cps C!c setend le setend be clrex dsb !l dmb isb srs XnW!m rfe XnW blx mcrr #& mrrc stc2 L#v stc ldc2 ldc cdp2 #y cdp mcr2 #z mcr mrc2 mrc sbfx dmir bfc dij bfi dmij ubfx strt daW ldrt strbt ldrbt ldr strb ldrb pop stm YnWl ldm XnWl bl imb imbrange swi strht ldrht ldrsbt ldrsht strh ldrh ldrd ldrsb strd ldrsh nop yield wfe wfi sev dbg !d mrs msr pFm pF2 bx clz bkpt movw dZ movt swp dmo swpb ldrex ldrexd ldrexb ldrexh strex dma strexd strexb strexh Sdn2 adc sbc rsc Dn2 teq cmn mov Sd2 mvn Snms mla Snmsd umull Sdnms smull umlal smlal adf PRfgh muf suf rsf dvf rdf pow rpw rmf fml fdv frd pol fpbop mvf PRfh mnf abs rnd sqt lgn sin cos tan asn acs atn fpuop stf QLv ldf PRgd fix PRdh wfs wfc rfc cmf PRgh cmfe cnfe vand vbic vorr vorn veor vbsl vbit vbif vshl SINuqw vqshl vrshl vqrshl vadd vtst vsub No support for this CPU type (%08x) in kernel cpu.branchpredict cpu.cache cpu.nocache xscale.branchpredict xscale.cache xscale.icache xscale.dcache undefined instruction %#x in kernel at %#lx booted_device booted_kernel console_device cpu_arch powersave cpu_id fpu_present hwdiv_present neon_present id_isar id_mmfr id_pfr id_mvfr simd_present simdex_present synchprim_present printfataltraps unaligned_sigbus machine_arch Warning IRQ's disabled during boot()
total memory = %s
avail memory = %s
single -s kdb -k -d ask -a quiet -q -v -x %s: curaddr %#lx not in range _bus_dmamap_sync: mix PRE and POST _bus_dmamap_sync: _BUS_DMA_BUFTYPE_RAW _bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID _bus_dmamap_sync: map %p: unknown buffer type %d
_bus_dmamem_map: size botch %dKB/%dB %d-way %s L%u %cI%cT Unified cache
%dKB/%dB %d-way L%u %cI%cT Instruction cache
%dKB/%dB %d-way %s L%u %cI%cT Data cache
sctlr: %#x
actlr: %#x
revidr: %#x
isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x
mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x
pfr: [0]=%#x [1]=%#x
Processor failed probe - no CPU ID
%s%s%s (%s V%s core) unknown CPU (ID = 0x%x) : %s %s
%s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU.
This kernel does not fully support this CPU.
Recompile with "options %s" to correct this.
arm700swibug vector abort terminal abort external linefetch abort (S) external linefetch abort (P) external non-linefetch abort (S) external non-linefetch abort (P) external translation abort (L1) external translation abort (L2) alignment abort (0) alignment abort (1) translation abort (S) translation abort (P) domain abort (S) domain abort (P) permission abort (S) permission abort (P) undefined insn traps undefined cp15 insn traps : disabled
: disabled (uniprocessor kernel)
write-through write-back **unknown 3** **unknown 4** write-back-locking write-back-locking-A write-back-locking-B **unknown 8** **unknown 9** **unknown 10** **unknown 11** write-back-locking-line write-back-locking-C write-back-locking-D CPU_ARM2 ARM2as CPU_ARM250 CPU_ARM3 CPU_ARM6 CPU_ARM7 CPU_ARM7TDMI CPU_ARM8 ARM9TDMI ARM9E-S CPU_ARM9E ARM9EJ-S ARM10E CPU_ARM10 ARM10EJ SA-1 CPU_SA110 XScale CPU_XSCALE_... ARM11J CPU_ARM11 ARMv4 CPU_ARMV4 Cortex CPU_CORTEX Marvell CPU_PJ4B ARM600 ARM610 ARM620 ARM700 ARM710 ARM7500 ARM710a ARM7500FE ARM810 SA-110 SA-1100 SA-1110 FA526 IXP1200 ARM710T ARM720T ARM740T (8 KB cache) ARM740T (4 KB cache) ARM920T ARM922T ARM940T TI ARM925T ARM946E-S ARM966E-S Sheeva 88SV131 Sheeva 88FR571-vd i80200 i80321 400MHz i80321 600MHz i80219 400MHz i80219 600MHz PXA27x PXA250 PXA210 PXA255/26x IXP425 533MHz IXP425 400MHz IXP425 266MHz ARM1020E ARM1022E-S ARM1026EJ-S ARM926EJ-S ARM1136J-S r0 ARM1136J-S r1 ARM1176JZ-S r0 ARM11 MPCore Cortex-A5 r0 Cortex-A7 r0 Cortex-A8 r1 Cortex-A8 r2 Cortex-A8 r3 Cortex-A9 r1 Cortex-A9 r2 Cortex-A9 r3 Cortex-A9 r4 Cortex-A15 r2 Cortex-A15 r3 Cortex-A17 r1 Cortex-A53 r0 Cortex-A57 r0 Cortex-A57 r1 Cortex-A72 r0 Sheeva 88SV581x Sheeva 88SV584x step 0 rev 1 rev 2 rev 3 rev 4 rev 5 rev 6 rev 7 rev 8 rev 9 rev 10 rev 11 rev 12 rev 13 rev 14 rev 15 step A-0 step A-1 step B-0 step B-1 step C-0 rev 0 step B-2 step D-0 (IXP1200 step A) (IXP1200 step B) (IXP1200 step C) (IXP1200 step D) (IXP1240/1250 step A) (IXP1240 step B) (IXP1250 step B) step B-3 step B-4 step B-5 step B step C step D step E rev 10step G step J step K step S step T *p0 *p1 *p2 *p3 *p4 *p5 *p6 *p7 *p8 *p9 *p10 *p11 *p12 *p13 *p14 *p15 Fatal %s mode data abort: '%s'
trapframe: %p
FSR=%08x, FAR= Invalid, Fatal %s mode prefetch abort at 0x%08x
trapframe: %p, spsr=%08x
r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x
r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x
r8 =%08x, r9 =%08x, r10=%08x, r11=%08x
r12=%08x, usp=%08x, ulr=%08x ssp=%08x, slr=%08x , pc =%08x
Fatal abort
Kernel mode double abort!
%d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x
r0=%08x r1=%08x r2=%08x r3=%08x
r4=%08x r5=%08x r6=%08x r7=%08x
r8=%08x r9=%08x rA=%08x rB=%08x
ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x
Non-emulated page fault with intr_depth > 0
uvm_fault(%p, %lx, %x) -> %x
UVM: pid %d (%s), uid %d killed: out of swap
%s: Misaligned Kernel-mode Program Counter
%s: invalid size (%zu) Vector Exception Alignment Fault 1 Terminal Exception Alignment Fault 3 External Linefetch Abort (S) Translation Fault (S) External Linefetch Abort (P) Translation Fault (P) External Non-Linefetch Abort (S) Domain Fault (S) External Non-Linefetch Abort (P) Domain Fault (P) External Translation Abort (L1) Permission Fault (S) External Translation Abort (L2) Permission Fault (P) kmpages pmap_bootstrap: No PTP for va %#lx
pmap_enter: failed to allocate L2 bucket pmap_enter: no pv entries pmap_init_l1: can't get PA of L1 at %p pmap_pv_protect: page not pv-tracked: 0x%lx fixup: pm %p, va 0x%lx, ftype %d - nothing to do!
fixup: l2 %p, l2b %p, ptep %p, pte %#x
fixup: pdep %p, pde %#x, fsr %#x
pmap_bootstrap: No L2 for va 0x%x, pa 0x%lx pmap_bootstrap: out of static L2s pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p
pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx
pmap_alloc_specials: no l2b for 0x%lx pmappl pvepl l2dtblpl l2ptppl Cannot allocate L1 KVM Cannot allocate L1 physical pages pmap_map_entry: no L2 table for VA 0x%08lx pmap_map_entry: can't find L2 table for VA 0x%08lx pmap_map_chunk: no L1 table provided %s: no L2 table for VA %#lx %s: can't find L2 table for VA %#lx xscale_setup_minidata: can't find L2 table for VA 0x%08lx
dump to dev %u,%u not possible
dumping to dev %u,%u offset %ld
dump area unavailable
device bad
device not ready
area improper
i/o error
aborted from console
succeeded
vmapbuf vunmapbuf pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytes pmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes) standby immediate command didn't complete
wd_standby: status=%s
wdstart1: bad return code from ata_bio() ST506 fictitious %s: ( error not notified device fault device timeout channel reset , retrying soft error (corrected)
wddump: try again wddump: polled command has been queued wddump: unknown atacmd code %d wddump: device timed out wddump: drive fault wddump: DMA error wddump: wddump: unknown error type %d wd_get_params: bad return code from ata_get_params ESDI IDENTIFY failed
SPLIT_MOD15_WRITEFORCE_LBA48 quirks %s
drive corrupts write transfers with certain controllers, consider replacing
drive supports %d-sector PIO transfers, LBA48 addressing
LBA addressing
chs addressing
%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors
WARNING: block size %u might not actually work
wd_setcache command not complete
wd_setcache: status=%s
flush cache command didn't complete
wd_flushcache: status=%s
trim command didn't complete
wd_trim: status=%s
wdioctlstrategy: No matching ioctl request found in queue
physio split wd ioctl request... cannot proceed
address mark not found track 0 not found aborted command media change requested id not found media changed uncorrectable data error bad block detected obsolete (address mark not found) no media/write protected interface CRC error ST3120023AS ST380023AS ST360015AS %s:%d:%d: bad state %d in wdc_ata_bio_intr
wdc_ata_bio_intr: bad state %s:%d:%d: device timeout, c_bcount=%d, c_skip%d
%s:%d:%d: read intr before drq
atacmd_to48: illegal 32-bit command: %d %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x
%s:%d:%d: not ready, st=0x%02x, err=0x%02x
recal piomode setmulti %s:%d:%d: %s timed out
%s:%d:%d: %s drive fault
error (%x)
wdc_ata_bio_kill_xfer: unknown reason %d
wdc_ata_bio_kill_xfer atabus at %s channel %d wd at %s drive %d %s: unknown child %p ataspl atainitq atadown can't alloc drive array
qidl ataact atdrn unable to create kernel thread: error %d
%scnf unable to create config thread: error %d
atath ata_thread: queue_freeze %s(%s:%d:%d): using PIO mode %d 32-bit data port
drive supports PIO mode %d %s DMA mode %d %s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133) SATA port multiplier not supported
atapibus at %s not configured
ata_hl atabus couldn't create dma map. (error=%d)
mmctaskq xfer 512 xfer 1024 xfer 2048 xfer 4096 xfer 8192 xfer 16384 xfer 32768 xfer 65536 xfer unaligned xfer error couldn't create task thread
" %s( manufacturer 0x%x%s product 0x%x%s standard function interface code 0x%x %sat %s function %d couldn't alloc memory (sdmmc function)
sdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set couldn't supply bus power
couldn't supply clock
couldn't enable card: %d
couldn't identify card
no functions
i/o init failed
mem init failed
bad CIS ptr %#x
CIS parse error at %d, tuple code %#x, length %d
CISTPL_FUNCE(common) found in function
CISTPL_FUNCE(common) too short
CISTPL_FUNCE(function) found in common
CISTPL_FUNCE(function) too short (v1.00)
CISTPL_FUNCE(function) too short
bad CISTPL_FUNCID length
bad CISTPL_MANFID length
CISTPL_VERS_1 too short
unknown tuple code %#x, length %d
%s: CIS version %u.%u
%s: CIS info: %s: Manufacturer code 0x%x, product 0x%x
%s: function %d: couldn't supply voltage requested by card
couldn't send I/O OCR
couldn't set I/O RCA
couldn't select I/O RCA %d
couldn't read CIS
can't change bus clock
switch error
error waiting for high speed switch: %d
can't read EXT_CSD (error=%d)
unrecognised future version (%d)
unknown CARD_TYPE: 0x%x
can't change high speed %d, error %d
can't re-read EXT_CSD
HS_TIMING set failed
can't switch signaling voltage
DDR52 HS200 can't execute MMC tuning
can't enable cache: %d
unknown SD CSD structure version 0x%x
unknown MMC CSD structure version 0x%x
unknown MMC version %d
couldn't set mem RCA
mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x
%s: %s failed with error %d
SD_SEND_SCR send failed.
can't change bus width (%d bit)
switch func mode 0 failed
failed to recover UHS card
switch func mode 1 failed: group 1 function %d(0x%2x)
can't get SD status: %d
%d-bit , C%d , U%d , V%d , A%d can't execute SD tuning
SD card status: unknown bus width write-protected
Default/SDR12 High-Speed/SDR25 SDR50 SDR104 DDR50 : <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x>
sdmmc discard count sdmmc discard errors sdmmc discard busy %sattach couldn't create thread
(disabled) %d-bit width, %s, %s cache%s, %u.%03u MHz
%u KHz
blkno 0x%llu exceeds capacity %d
, retrying
ld_sdmmc config_hook: invalid hook type config_hook: incompatible mode on type=%d/id=%ld != %d config_hook: type=%d/id=%ld is replaced config_hook: type=%d/id=%ld is already hooked(%p) config_hook: malloc failed config_connect: malloc failed config_connect: can't connect with shared hook, type=%d id=%ld UNKNOWN CASIO Compaq HP HP Jornada addr 0x%lx -0x%lx intr %d PXA270 Kernel is configured for %s, but CPU is %s
: Onchip Peripheral Bus
pxaip_attach: failed to map CLKMAN pxaip_attach: failed to map MEMCTL pxaip_measure_cpuclock: can't map RTC %s: CPU clock = %d.%03d MHz
%s: kernel is configured for PXA250, cpu type is %s
pxaintc pxaip_attach_critical: failed to attach INTC! pxagpio pxaip_attach_critical: failed to attach GPIO! pxaip pxa2x0_memctl_read: not bootstrapped pxa2x0_memctl_write: not bootstrapped pxa2x0_clkman_config: not bootstrapped pxa2x0_io_bs_alloc(): not implemented
pxa2x0_io_bs_free(): not implemented
stray interrupt %d
: Interrupt Controller
intr_establish: bogus irq number %d intr_disestablish: bogus irq number %d pxagpio_reg_read: not bootstrapped pxagpio_reg_write: not bootstrapped : GPIO Controller
Can't map registers!
failed to hook main GPIO interrupt
unhandled GPIO interrupt. GPIO#%d
pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0 pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1 pxa2x0_gpio_intr_establish: bad pin number: %d pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN pxa2x0_gpio_intr_establish: bad level: %d pxa2x0_gpio_intr_establish: illegal shared interrupt pxa2x0_gpio_set_intr_level: bad level: %d : can't map registers
pxauart %s: Cannot map registers SA-11x0 OS Timer
clock: hz=%d stathz=%d
saost_count saost Stray DMAC interrupt for unallocated channel %d
: DMA Controller
dmac_pxaip_attach: bus_dmamem_alloc failed dmac_pxaip_attach: bus_dmamem_map failed dmac_pxaip_attach: bus_dmamap_create failed dmac_pxaip_attach: bus_dmamap_load failed pxa2x0_dmac_abort_xfer: channel %d failed to abort pxadmac pxapcic_mem_map: bogus kind pcic_attach_card: already attached %s,%d unable to create event thread for %d
pxapcicev pxapcicss : %d slot%s
can't attach
failed to map MEMCTL
pcmciabus unable to map register
%s: Bus Error Detected
Interrupt not handled 0x%x
: Real-time Clock
%s: couldn't map registers
%s: using wristwatch register
pxartc pxamci_dmac_ointr: non-zero completion status %d
pxamci_dmac_iintr: non-zero completion status %d
mmclk clock stop timeout
data not a multiple of %u bytes
too much data
couldn't start dma xfer. (error=%d)
mmcmd unsupported bus frequency of %d KHz
: MMC/SD Controller
couldn't establish MMC interrupt
using DMA transfer
couldn't alloc rx dma xfer
couldn't alloc tx dma xfer
couldn't attach bus
apmsuspend power management disabled real mode interface already connected interface not connected 16-bit interface already connected 16-bit interface not supported 32-bit interface already connected 32-bit interface not supported unrecognized device ID parameter out of range interface not engaged unable to enter requested state no pending events no APM present unknown error code APM reserved APM: %s event code %x
get event apmstandby apmev ioctl get power status apm at %s Power Management spec V%d.%d unable to create thread, kernel APM support disabled
reserved system reserved device OEM defined apmdev pcmcia_childdetached: %s not found
%s: error %d detaching %s (function %d)
(manufacturer 0x%04x, product 0x%04x) function %d: %s
pcmcia_function_init: function is enabled %s: card appears to have bogus CIS
pcmcia_function_enable: function not initialized %s: couldn't map the CCR
pcmcia_io_map: function is enabled!
pcmcia_io_unmap: function is enabled!
pcmcia_intr_establish: function is enabled!
pcmcia_intr_establish: already done
interrupt establish failed
pcmcia_intr_disestablish: function is enabled!
pcmcia_intr_distestablish: already done
Drats! I need a skew!
Cannot allocate cfe entry
CIS checksum failed
%s: CIS version PCMCIA 1.0
PCMCIA 2.0 or 2.1
PC Card Standard %d.%d
unknown (major=%d, minor=%d)
unspecified multi-function serial port parallel port fixed disk (ata) video adapter network adapter auto incrementing mass storage SCSI bridge Security services Instrument unknown (%d) , ccr addr %lx mask %lx
%s: function %d, config table entry %d: memory card I/O card card type unknown ; irq mask %x ; iomask %lx, iospace %lx -%lx ; memspace @%lx ; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio %s: %d errors found while parsing CIS
%s: using CIS quirks for pcmcia_check_cis_quirks: malloc pf pcmcia_check_cis_quirks: malloc cfe SVEC FD605 PCMCIA EtherNet Card NDC PCMCIA MBH10302 can't alloc mem for enet addr
can't map mem for enet addr
configure failed, error=%d
can't get subregion for asic
can't match ethernet vendor code
cannot set power mgmt handler
unable to establish power handler
PCMCIA AmbiCom Inc AMB8002T AmbiCom,Inc. Fast Ethernet PC Card(AMB8110) PMX PE-200 UE2212 D-Link DE-660 DE-660+ RPTI LTD. EP400 RPTI EP401 Ethernet NE2000 Compatible ACCTON EN2212 EN2216-PCMCIA-ETHERNET Seiko Epson Corp. P/N: EEN10B Rev. 00 TAMARACK CNet CN40BC Ethernet PCMCIA-ETHERNET-CARD UE2216 ASIX AX88190 DFE-670TXD MELCO LPC2-TX LINKSYS E-CARD DE-650 I-O DATA PCLA corega K.K. corega Ether CF-TD LAN Card corega Ether PCC-T corega Ether PCC-TD corega Ether PCC-TL corega EtherII PCC-T corega EtherII PCC-TD corega FastEther PCC-TX corega FEther PCC-TXF corega FEther PCC-TXD corega FEtherII PCC-TXD (CG-LAPCCTXD) (HardwareFirmwareVer.) SMC 8041TX-10/100-PC-Card-V2 LNT-10TN CF 10Base-Ethernet 1.0 DYNALINK L10C ne_pcmcia couldn't establish interrupt
MEGAHERTZ MODEM XJ2288 com_pcmcia can't subregion I/O space
memory mapped mode
i/o mapped mode
wdcattach Digital Mobile Media CD-ROM PCMCIA Portable CD-ROM Drive NinjaATA- EXP PnPIDE F1 SHUTTLE TECHNOLOGY LTD. PCCARD-IDE/ATAPI Adapter FREECOM PCCARD-IDE IO DATA CBIDE2 LOOKMEET IDE CARD wdc_pcmcia wiinit couldn't load firmware
failed to attach controller
SMC2632W NANOSPEED HFA384x/IEEE NEC Wireless Card CMZ-RT-WP NTT-ME 11Mbps Wireless LAN PC Card Wireless LAN PCC-11 Wireless LAN PCCA-11 corega_K.K. Wireless_LAN_PCCB-11 WL PCCL-11 WLCFL-11 INTERSIL Intersil PRISM 2_5 PCMCIA ADAPTER PLANEX GW-NS11H Wireless LAN PC Card D-Link Corporation D-Link DWL-650H 11Mbps WLAN Adapter wi_pcmcia vendor %4.4x product %4.4x unable to flush cache
lddrain %s: not drained
dk_subr Lucent/Prism/Symbol 802.11 controls %s: sysctl_createv failed (rc = %d)
timeout in wi_seek to %x/%x
%s: failed in wi_seek to %x/%x
command timed out, cmd=0x%x, arg=0x%x
command failed, cmd=0x%x, arg=0x%x
detect auto increment bug, try again
wi_cmd: busy bit won't clear.
xmit failed
%s: %d tx cmds pending!!!
record read mismatch, rid=%x, got=%x
record buffer is too small, rid=%x, size=%d, len=%d
%s: invalid channel %d
%s: cleaning outstanding rssadapt descriptor for %s
%s: tx rate %d -> %d (%d)
%s write fid %x failed
%s read fid %x failed
%s: null node %s bad idx %02x
%s null node, rssdesc %02x
%s txpending[%i] wraparound tx failed , retry limit exceeded , max transmit lifetime exceeded , port disconnected , invalid format (data len %u src %s) , status=0x%x wi_scan_result: unknown firmware type %u
failed to allocate %d bytes on NIC
timeout in alloc
tx buffer allocation failed
%s: interface not running
%s: device timeout
Lucent Symbol could not establish softint
could not get mac address, attach failed
802.11 address %s
%s: using Unknown PRISM2 chip Unknown Lucent chip
%s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u)
using default channel list
no available channel
no supported rate list
if_initialize failed(%d)
Lucent Technologies, WaveLAN/IEEE Sony WaveLAN/IEEE Lucent Embedded WaveLAN/IEEE RF:PRISM2 MAC:HFA3841 RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.B RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.A RF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.B RF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVAL RF:PRISM1 MAC:HFA3841 CARD:HWB1153 RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flash RF:PRISM2.5 MAC:ISL3873B(PCMCIA) RF:PRISM2.5 MAC:ISL3874A(Mini-PCI) RF:PRISM2.5 MAC:ISL3874A(PCI-bridge) RF:PRISM3 MAC:ISL3871(PCMCIA) RF:PRISM3 MAC:ISL3871(Mini-PCI) : failed to clear NIC buffer at offset %x - check configuration
dp8390_start: no header mbuf Ethernet address %s
%s: NIC memory corrupt - invalid packet length %d
device enable failed
ne2000_write_mbuf: negative len %s: remote transmit DMA failed to complete
where did the card go?
setup failed
%s: %d silo overflow%s, %d ibuf flood%s
' ns16550, broken fifo ns8250 or ns16450, no fifo ns16550a, working fifo Au1X00 UART, working fifo ns16650, no ERS, working fifo OMAP UART, working fifo Ingenic UART, working fifo Tegra UART, working fifo is_console can't re-init serial console @%lx
txfifo disabled
unable to allocate ring buffer
10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto
10base2
10baseT-FDX
10baseT
atarst %s:%d: %s
%s:%d:%d: %s
%s channel %d: reset failed for drive 0 drive 1 __wdccommand_kill_xfer: unknown reason %d
__wdccommand_kill_xfer atapi lost interrupt type: %s tc_bcount: %d tc_skip: %d
missing untimeout atapoll atadrdy atacnf wdccmd atardl crypto_core_constant32[0] == le32dec(&sigma[0]) crypto self-test failed: %s crypto_core_constant32[1] == le32dec(&sigma[4]) crypto_core_constant32[2] == le32dec(&sigma[8]) crypto_core_constant32[3] == le32dec(&sigma[12]) block[i] == le32dec(&out[i*4]) expand 32-byte k invalid vap id %d vap id %d not allocated invalid channel freq %u flags %x
invalid channel (NULL)
%s: mode %u not supported (caps 0x%x)
Unexpected mode %u %s: no channels found for mode %u
Bad IBSS channel %u bad channel ignored; freq %u flags %x number %u
vap table full .5 %s: %s rates: %s%d%sMbps %s: no 802.11 instance!
11a 11b 11g FH turboA turboG AMRR increasing rate %d (txcnt=%d retrycnt=%d)
AMRR decreasing rate %d (txcnt=%d retrycnt=%d)
No cipher! %s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u
%s: driver did not delete key index %u
%s: cipher %s has an invalid cipher index %u
%s: cipher %s registered with a different template
%s: invalid cipher %u
%s: unregistered cipher %u, load module %s
%s: unable to load cipher %u, module %s
%s: no h/w support for cipher %s, falling back to s/w
%s: no h/w support for TKIP MIC, falling back to s/w
%s: unable to attach cipher %s
%s: no h/w resources for cipher %s, falling back to s/w
%s: unable to setup cipher %s
%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u
%s: cipher %s rejected key index %u len %u flags 0x%x
%s: no key index; should not happen!
[%s] no default transmit key (%s) deftxkey %u
%s: WEP data frame too short, len %u
[%s] unable to pullup %s header
wlan_wep wlan_tkip wlan_aes_ocb wlan_ccmp wlan_ckip %s: Invalid key length %u, expecting %u
%s: control frame [%s] Missing ExtIV for AES-CCM cipher
not enough data in following buffer, m_len %u need %u
[%s] AES-CCM decrypt failed; MIC mismatch
AES-CCM [%s] key id %u is not set (decap)
[%s] key id %u is not set (encap)
NONE out of buffers with data_len %zu
[%s] missing ExtIV for TKIP cipher
[%s] discard frame due to countermeasures (%s)
[%s] TKIP ICV mismatch on decrypt
[%s] Discard frame due to countermeasures (%s)
TKIP [%s] out of data for WEP (data_len %zu)
[%s] WEP ICV mismatch on decrypt
WEP [%s:%s] discard %s frame, %s information element, too short, len %u WME [%s] discard %s frame, ssid mismatch: too short (1): len %u wrong version %x node %s, %s not to bss not to cur sta: lladdr=%6D, addr1=%6D too short (2): len %u bss %s, broadcast %s, %s seqno <%u,%u> fragno <%u,%u> tid %u duplicate data too short: expecting %u unknown dir 0x%x multicast echo unknown src unassoc src [%s] power save mode on, %u sta's in ps mode
[%s] power save mode off, %u sta's in ps mode
[%s] flush ps queue, %u packets queued
multicast fragm? demic error decap error unauthorized port: ether type 0x%x len %u too short: len %u mgt received %s from %s rssi %d
WEP set but not permitted WEP set but PRIVACY off ps-poll unassociated station aid mismatch: sta aid 0x%x poll aid 0x%x [%s] recv ps-poll, but queue empty
[%s] recv ps-poll, send packet, %u still queued
[%s] recv ps-poll, send packet, queue empty
bad frame type 0x%x [%s] extended rate set too large; only using %u of %u rates
[%s] shared key challenge alloc failed
reassoc WPA RSN , protection , QoS ie too short bad len %u ERP id %u, len %u unhandled no scan.rates bad scan.rates len %d no scan.ssid bad scan.ssid len %d invalid channel %u for off-channel %u bogus beacon interval [%s] erp change: was 0x%x, now 0x%x
[%s] capabilities change: before 0x%x, now 0x%x
no rates bad rates len %d no ssid bad ssid len %d no ssid with ssid suppression enabled [%s] recv probe req
recv'd rate set invalid [%s] recv auth frame with algorithm %d seq %d
disallowed by ACL TKIP countermeasures enabled shared key auth PRIVACY is disabled bad sta auth mode %u ie %d/%d too long no challenge bad challenge len %d bad operating mode %u bad state %u [%s] shared key %sauth request
shared key response unknown station no challenge recorded challenge mismatch [%s] station authenticated (shared key)
bad seq %d [%s] shared key auth failed (reason %d)
open auth [%s] station authenticated (open)
[%s] open auth failed (reason %d)
unsupported alg %d wrong bssid [%s] deny %s request, sta not authenticated
[%s] no WPA/RSN IE in association request
not WPA, flags 0x%x bad version %u mcast cipher mismatch; got %u, expected %u ucast cipher data too short; len %u, n %u ucast cipher set empty key mgmt alg data too short; len %u, n %u no acceptable key mgmt alg not RSN, flags 0x%x [%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x
[%s] deny %s request, capability mismatch 0x%x
[%s] deny %s request, rate set mismatch
[%s] %sassoc failed (reason %d)
[%s] %sassoc failed (rate set mismatch)
[%s] %sassoc success: %s preamble, %s slot time%s%s
[%s] recv deauthenticate (reason %d)
[%s] recv disassociate (reason %d)
subtype 0x%x not handled [%s] %s
link-layer statistics and controls IEEE 802.11 WLAN statistics and controls ieee80211 %s: sysctl_createv failed, rc = %d
client/peer stations vap%u inact_run inact_probe inact_auth inact_init driver_caps bmiss_max %s: 802.11 mgt frame too large: %u bad beacon boundary bss %snode %s join
%snode %s leave
notify scan done
[%s] %s replay detected
[%s] michael MIC verification failed
%s: load the %s module by hand for now.
bogus aid %u, max %u %s %p<%s> in %s table
0x%p: mac %s refcnt %d
scangen %u authmode %u flags 0x%x
associd 0x%x txpower %u vlan %u
txseq %u rxseq %u fragno %u rxfragstamp %u
rstamp %u rssi %u intval %u capinfo 0x%x
bssid %s essid "%.*s" channel %u:0x%x
fails %u inact %u txrate %u
%s: IEEE80211_LOCK not held %s: remove %p<%s> from %s table, refcnt %d
%s: %p<%s> clear key map entry
[%s] scan candidate purged from cache (refcnt %u)
%s: free all nodes in %s table
%s %s table
%s: %s[%u] still active
???? ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set: %s%u start chan %u
passive %s: end %s scan
ni != NULL refcnt(ni) == %d ic != NULL %s: fixed rate %d (%d.%d Mb/s) not in rate set %s %p<%s>
%s: add key map entry %p<%s> refcnt %d
[%s] no node, discard frame (%s)
%s %p<%s> refcnt %d
%s: %p<%s> clear key map entry neighbor %s: creating ibss
%s: merge failed, capabilities mismatch
%s: new bssid %s: %s preamble, %s slot time%s
%s: no scan candidate
macaddr bssid chan rssi rate flag wep essid %s
%s: chan %d->%d
begin %s scan in %s mode, scangen %u
new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02x key map out of sync, ni %p nikey %p %s: delete key map entry %p<%s> refcnt %d
%s: scan aborted %u
[%s] station with aid %d leaves
unexpected operating mode %u bogus long slot station count %d [%s] long slot time station leaves, count now %d
%s: re-enable use of short slot time
bogus non-ERP station count %d [%s] non-ERP station leaves, count now %d
%s: disable use of protection
%s: re-enable use of short preamble
%s: %s scangen %u
[%s] discard frame, age %u
[%s] discard %u frames for age
probe station due to inactivity station timed out due to inactivity (refcnt %u) [%s] station needs long slot time, count %d
[%s] station is !ERP, %d non-ERP stations associated
%s: enable use of protection
[%s] station needs long preamble
[%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s
unable to setup inital BSS node %s: no memory for AID bitmap!
%s: no memory for TIM bitmap!
%s %s table, inact %u
Cannot allocate key index map with %u entries
scan ena [%s] send null data frame on channel %u, pwr mgt %s
no ethernet header! %s: cannot expand storage
not enough room, need %u got %zu
[%s] enmic failed, discard frame
mbuf already chained? pktlen %u mtu %u fragment size %u too big! %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x
no WPA/RSN! RSN IE too big, %u > %zu WPA IE too big, %u > %zu ieee80211_ref_node (%s:%u) %p<%s> refcnt %d
[%s] send probe req on channel %u
[%s] request encrypt frame (%s)
[%s] send station deauthenticate (reason %d)
[%s] send station disassociate (reason %d)
[%s] invalid mgmt frame type %u
[%s] encrypting frame (%s)
[%s] send %s on channel %u
%s: cannot get buf; size %u
no space for 802.11 header? %s: traffic %u, disable aggressive mode
%s: traffic %u, enable aggressive mode
tim bitmap empty! %s: TIM updated, pending %u, off %u, len %u
[%s] pwr save q overflow, drops %d (size %d)
[%s] save frame with age %d, %u now queued
wlan: %s acl policy registered
wlan: %s acl policy unregistered
wlan_acl 0x %s: %s -> %s
no recent beacons from %s; rescanning
%s: invalid transition
%s: bogus xmit rate %u setup
associated synchronized with %s ssid channel %d start %uMb
NODS %s ->%s TODS %s FRDS %s DSDS %s ->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d %s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s log2(cwmin) %u
%s: WME params updated, cap_info 0x%x
%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
%s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u]
beacon miss wlan_internal wlan_xauth WME_AC_BE WME_AC_BK WME_AC_VI WME_AC_VO WME_UPSD INIT SCAN AUTH ASSOC RUN reserved#0 reserved#1 reserved#2 reserved#3 reserved#5 reserved#6 reserved#7 reserved#8 reserved#9 ps_poll rts cf_end cf_end_ack reassoc_req reassoc_resp probe_req probe_resp beacon atim disassoc deauth reserved#13 reserved#14 reserved#15 rssadapt expavgctl %s: dst %s threshold[%d, %d.%d] %d < %d
%s: src %s rssi %d avg %d -> %d
ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds
%s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d
%s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds
%d-byte , T[%d.%d] = %d external %hu.%hhu %s:%hhu igmppl inet igmp lla_lookup: new lle malloc failed
inmltpl multicast subnetsarelocal hostzerobroadcast invalid argument to in_lifaddr_ioctl in_control inpcbpl %d.%d.%d.%d %s:%hu internet icmp maskrepl returndatabytes errppslimit rediraccept redirtimeout bmcastecho ICMP: redirect failed to register timeout for route to %s, code %d
icmp_error icmp len forwarding redirect ttl forwsrcrt directed-broadcast allowsrcrt mtudisc anonportmin anonportmax mtudisctimeout lowportmin lowportmax checkinterface random_id do_loopback_cksum dad_count anonportalgo available selected reserve %s: refusing to send from invalid address %s (pid %d)
maxfragpackets ipfrenpl rip_abort rip_accept pcblist (unknown) TCP: invalid wscale %d from %s, assuming %d
tcpipqepl tcp_pulloutofband synpl m_pulldown malfunction Connection attempt to TCP %s:%d from %s:%d
(unknown v6) Connection attempt to TCP [%s]:%d from [%s]:%d
tcp_output REXMT tp->t_lastm == NULL tcp_output sackholepl tcp_init tcpcbpl tcp_new_iss rfc1323 sendspace recvspace mssdflt minmss msl syn_cache_limit syn_bucket_limit init_win mss_ifmtu sack congctl win_scale timestamps compat_42 cwm cwm_burstsize ack_on_push keepidle keepintvl keepcnt slowhz log_refused rstppslimit delack_ticks init_win_local keepinit recvbuf_auto recvbuf_inc recvbuf_max sendbuf_auto sendbuf_inc sendbuf_max ecn enable maxretries globalmaxholes globalholes local_by_rtt drop iss_hash abc aggressive mslt remote remote_threshold vtw %s: af %d tcp6 inet6 newreno cubic %s: could not allocate %zu bytes for hash anchors %s: could not allocate %zu bytes for fatp_t array %s: could not allocate %zu bytes for vtw_t array udp_abort udp_accept udp checksum random_start random_pick doublehash randinc (src=%s dst=%s tgt=%s) icmp6 nd6_prune nd6_delay nd6_umaxtries nd6_mmaxtries nd6_useloopback nodeinfo nd6_maxnudhint mtudisc_hiwat mtudisc_lowat nd6_debug nd6_drlist nd6_prlist maxqueuelen %s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d
/usr/src/sys/netinet6/icmp6.c %s: source can't be determined: dst=%s, error=%d
%s: ENOBUFS in icmp6_error %d
%s: ICMP6 redirect sent from %s rejected; must be from linklocal
%s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255)
%s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s
%s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s
%s: ICMP6 redirect rejected; no route found for redirect dst: %s
%s: ICMP6 redirect rejected; redirect dst must be unicast: %s
%s: ICMP6 redirect rejected; neither router case nor onlink case: %s
%s: invalid ND option, rejected: %s
%s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s
%s: ICMP6 checksum error(%d|%x) %s
%s: unknown type %d(src=%s, dst=%s, ifid=%d)
%s: in6_setscope failed
IPv6 address: "%s" is not on the network
%s: a destination can be specified for a p2p or a loopback IF only
%s: prefixlen should be 128 when dstaddr is specified
%s: valid lifetime is 0 for %s
%s: the prefix length of an existing (%s) autoconf address should not be changed
%s: addmulti failed for %s on %s (errno=%d)
in6_are_prefix_equal: invalid prefix length(%d)
in6_prefixlen2mask: invalid prefix length(%d)
invalid argument to in6_lifaddr_ioctl prefix ioctls are now invalidated. please use ifconfig.
%s: %s marked tentative
%s: %s marked detached
in6_if2idlen: unknown link type (%d)
in6_cksum: offset too short for IPv6 header in6_cksum: mbuf too short for IPv6 header %s: never found a good ID
%s: %s has too small MTU, IPv6 not enabled
%s: %s is not multicast capable, IPv6 not enabled
%s: failed to configure the loopback address on %s (errno=%d)
%s: %s: got interface identifier from itself
%s: %s: got interface identifier from %s
%s: %s: borrow interface identifier from %s
%s: %s: interface identifier generated by random number
%s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x
%s: failed to configure a link-local address on %s (errno=%d)
%s: cannot assign link-local address
in6pcbpl ::ffff:%s [%s]:%hu internet6 Cannot forward from %s@%s to %s@%s nxt %d (%s)
mcast/dst bcast/mcast unspec/src src[%s] inzone %d outzone %d dst[%s] inzone %d outzone %d ip6 accept_rtadv rtadv_maxroutes rtadv_numroutes keepfaith log_interval hdrnestlimit auto_flowlabel defmcasthlim NetBSD-current kame_version use_deprecated rr_prune v6only auto_linklocal addctlpolicy use_tempaddr prefer_tempaddr temppltime tempvltime maxfrags use_defaultzone mcast_pmtu neighborgcthresh maxifprefixes maxifdefrouters maxdynroutes ip6_init %s: off < sizeof(struct ip6_hdr) ip6_nexthdr: m == NULL %s: packet to an unready address %s->%s
pim6 register_mif multiple kernel entries add_m6fc: %s o %s g %s p %x dbx %p
cannot forward from %s to %s nxt %d received on %s
ip6_mforward: ip6_mrouter socket queue full
assumption failed: hdr not split multicast_kludge regen_tmpaddr: failed to create a new tmp addr, errno=%d
nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu
scope error in prefix list (%s)
scope error in router list (%s)
nd6_timer %s: workqueue_create failed (%d)
%s: duplicated ND6 option found (type=%d)
%s: nd6_options: unsupported option %d - option ignored
%s: too many loop in nd opt
Cannot enable an interface with a link-local address marked duplicate.
%s: can't allocate llinfo for %s (ln=%p, rt=%p)
%s: failed to set scope %s (errno=%d)
%s.%d: sockaddr_dl_init(, %zu, ) failed on %s
%s: rt_setgate failed on %s
nd6_rtrequest: bad gateway value: %s
%s: %s: failed to join %s (errno=%d)
%s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d
%s: DAD complete for %s - duplicate found
%s: manual intervention required
%s: possible hardware address duplication detected, disable IPv6
%s: invalid hlim (%d) from %s to %s on %s
%s: invalid target address %s
%s: a solicited adv is multicasted
%s: invalid ND option, ignored
%s: lladdrlen mismatch for %s (if %d, NA packet %d)
nd6_na_input: duplicate IP6 address %s
%s: ND packet from non-neighbor %s on %s
nd6_dad_timer: called with duplicate address %s(%s)
nd6_dad_timer: called with non-tentative address %s(%s)
%s: %s: could not run DAD, driver problem?
%s: %s: DAD complete for %s - no duplicates found
%s: bad DAD packet (wrong ip6 dst)
%s: NS packet from non-neighbor %s on %s
%s: bad NS target (multicast)
%s: bad DAD packet (link-layer address option)
%s: lladdrlen mismatch for %s (if %d, NS packet %d)
%s: duplicate IP6 address %s
%s: src=%s
%s: dst=%s
%s: tgt=%s
nd6_dad_start: called with non-tentative address %s(%s)
nd6_dad_start: memory allocation failed for %s(%s)
%s: %s: starting DAD for %s
%s: preferred lifetime(%d) is greater than valid lifetime(%d)
%s: %s/%d is already on-link
%s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s
%s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d
rtpref: impossible RA flag %x
%s: %s/%d is already off-link
%s: failed to recover a prefix %s/%d from %s to %s (errno = %d)
%s: failed to delete route: %s/%d on %s (errno = %d)
%s: lladdrlen mismatch for %s (if %d, RS packet %d)
%s: called unexpectedly (forwarding=%d, accept_rtadv=%d)
nd6_defrouter_select: more than one router is installed
%s: failed to make %s/%d offlink on %s, errno=%d
%s: failed to make %s/%d offlink, errno=%d
%s: failed to make %s/%d onlink, errno=%d
nd6_prelist_remove: negative count on %s
%s: failed to find a good random IFID
%s: failed to find a unique random IFID
%s: ifa update succeeded, but we got no ifaddr
nd6_defrtrlist_del: negative count on %s
%s: src %s is not link-local
nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored
%s: invalid option len %d for prefix information option, ignored
%s: invalid prefix len %d for prefix information option, ignored
%s: invalid prefix %s, ignored
%s: failed to make the prefix %s/%d on-link on %s (errno=%d)
%s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p
%s: IFID undefined (%s)
%s: invalid prefixlen %d for %s, ignored
%s: wrong prefixlen for %s (prefix=%d ifid=%d)
in6_ifadd: %s is already configured
%s: failed to make ifaddr %s on %s (errno=%d)
%s: failed to create a temporary address, errno=%d
%s: bogus mtu option mtu=%lu sent from %s, ignoring
%s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring
%s: lladdrlen mismatch for %s (if %d, RA packet %d)
raw6 sa6_recoverscope: assumption failure (non 0 ID): %s%%%d
site organization global udp6_output: IPV6_V6ONLY option was set for a connected socket
udp6 addr 0x%x iicintr : I2C bus
unable to create intr thread
i2c-indirect-config i2c-child-devices cookie compatible WARNING: ignoring bad device address @ 0x%02x
%s at %s addr 0x%02x WARNING: intr handler list not empty
WARNING: proc handler list not empty
i2cexec,i2c_bitbang i2cexec iic at %s mii_attach: phyloc and offloc specified mii mii_detach: phyloc and offloc specified OUI 0x%06x model 0x%04x rev %d at %s phy %d miiverbose miiaut mii_phy_setmedia: MASTER on wrong media HomePNA1 10baseT 10baseT-FDX 100baseTX 100baseTX-FDX 100baseT4 1000baseSX 1000baseSX-FDX 1000baseT 1000baseT-FDX couldn't establish power handler : Media interface
: %s, rev. %d
bge bnx phyflags failed to get phyflags
chipid failed to get chipid
shared_hwcfg failed to get shared_hwcfg
port_hwcfg failed to get port_hwcfg
2500baseSX-FDX, BCM5400 1000BASE-T media interface BCM5401 1000BASE-T media interface BCM5411 1000BASE-T media interface BCM5421 1000BASE-T media interface BCM5462 1000BASE-T media interface BCM5461 1000BASE-T media interface BCM54K2 1000BASE-T media interface BCM5464 1000BASE-T media interface BCM5701 1000BASE-T media interface BCM5703 1000BASE-T media interface BCM5704 1000BASE-T media interface BCM5705 1000BASE-T media interface BCM5706 1000BASE-T/SX media interface BCM5714 1000BASE-T/X media interface BCM5750 1000BASE-T media interface BCM5752 1000BASE-T media interface BCM5780 1000BASE-T/X media interface BCM5708C 1000BASE-T media interface BCM5481 1000BASE-T media interface BCM5482 1000BASE-T media interface BCM5708S 1000/2500baseSX PHY BCM5709 10/100/1000baseT PHY BCM5709S 1000/2500baseSX PHY BCM5709CAX 10/100/1000baseT PHY BCM5722 1000BASE-T media interface BCM5754/5787 1000BASE-T media interface BCM5755 1000BASE-T media interface BCM5756 1000BASE-T media interface XXX BCM5761 10/100/1000baseT PHY BCM5784 10/100/1000baseT PHY BCM5785 1000BASE-T media interface BCM5717C 1000BASE-T media interface BCM5719C 1000BASE-T media interface BCM5720C 1000BASE-T media interface BCM57765 1000BASE-T media interface BCM57780 1000BASE-T media interface BCM5725C 1000BASE-T media interface BCM5906 10/100baseTX media interface brgphy no media present DP83840 10/100 media interface nsphy DP83843 10/100 media interface DP83847 10/100 media interface DP83849 10/100 media interface DP83815/DP83846A 10/100 media interface nsphyter QS6612 10/100 media interface qsphy i82555 10/100 media interface i82562EH HomePNA interface i82562EM 10/100 media interface i82562ET 10/100 media interface i82562G 10/100 media interface inphy i82553 10/100 media interface iophy : 3Com internal media interface
ignoring this PHY, non-zero instance
no media present
exphy_service: can't isolate 3Com PHY exphy 100baseFX, 100baseFX-FDX, LXT970 10/100 media interface LXT971/2 10/100 media interface lxtphy ICS1889 10/100 media interface ICS1890 10/100 media interface ICS1892 10/100 media interface ICS1893 10/100 media interface icsphy using Seeq 84220 isolate/reset hack
Seeq 80220 10/100 media interface Seeq 80225 10/100 media interface Seeq 84220 10/100 media interface sqphy DM9101 (AMD Am79C873) 10/100 media interface DM9102 10/100 media interface dmphy Am79C901 HomePNA 1.0 interface pnaphy : %s (OUI 0x%06x, model 0x%04x), rev. %d
: OUI 0x%06x, model 0x%04x, rev. %d
ukphy dmover_backend_unregister dmover dmreq dmses dmover_session_destroy %s: emergency X server detach
added (%s , %s emulation wsdisplay_switch1: not switching
wsdisplay_switch1: invalid screen %d wsdisplay_switch1: screen %d disappeared
wsdisplay_switch3: not switching
wsdisplay_switch3: invalid screen %d wsdisplay_switch3: screen %d disappeared
wsdisplay_switch3: giving up
wsdisplay_switch2: not switching
wsdisplay_switch2: invalid screen %d wsdisplay_switch2: screen %d disappeared
wsdisplay_switch2: giving up
wsdisplaytty() on status device wsdisplaytty() on ctl device wsdisplay_common_attach: no memory kbdmux %d : console (%s, %s emulation) , using %s wssw screen %d deleted
wsdisplay at %s wsdisplay: event queue overflow
wswait wsdisplay_noemul wsdisplay_emul EDID dumb wsemul_vt100_output_c0c1: ESC in kernel output ignored
vt100 [>24;20;0c P2$u %s%d P0!u%5\ [?62;6c [8;%d;%dt [0n [%d;%dR [?13n [?21n [?27;1n wsemul_vt100_handle_dcs: bad type %d OI OM Oj Ok Ol Om On Oo [28~ [29~ [1~ [2~ [3~ [4~ [5~ [6~ [7~ [8~ OA [A OB [B OD [D OC [C Op Oq Or Os Ot Ou Ov Ow Ox Oy OP OQ OR OS [11~ [12~ [13~ [14~ [15~ [17~ [18~ [19~ [20~ [21~ [23~ [24~ [25~ [26~ [31~ [32~ [33~ [34~ %s: unknown version %d wsevent_read mux %d cannot load keymap : console keyboard attach error=%d
couldn't register as input device
connecting to %s
wskdet wskbd_detach: %s didn't detach
wskbd at %s %s: event queue overflow
wskbd wskbd_get_mapentry: %d(%d): bad entry wskbd_load_keymap: %d: recursion too deep wskbd_load_keymap: %d(%d): bad entry wsmux_getmux: no memory for mux %d
wsmux wsmux: attach out of memory
%s: disconnecting from %s
rasops_init: fontwidth assumptions botched! rasops_init: font table is empty
rasops_init: couldn't lock font
fontwidth not 8/12/16 or RASOPS_SMALL - fixme! ccw wsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d
wsfont_unlock: font not locked Boldface cd9660nopl RRIP with incorrect NM flags?
RRIP without PX field?
RRIP with incorrect flags? IEEE_1282 IEEE_P1282 RRIP_1991A SP fhtovp: lbn exceed volume space %d
fhtovp: crosses block boundary %d
fhtovp: bread error %d
fhtovp: directory crosses block boundary %d[off=%d/len=%d]
cd9660 utf8_joliet %/@ %/C %/E root_device cd9660_strategy: spec tag VT_ISOFS, isofs vnode
msdosnopl msdosfhpl loadvnode(): pcbmap returned %d
deextend: file too large detrunc(): can't truncate root directory, clust %ld, offset %ld
%s: copy FAT %d (error=%d)
%s: write FAT (error=%d)
. .. doscheckpath(): .. not a directory?
msdosfs_sync: rofs mod msdosfs RRaA rrAa msdos msdosfs_write(): bad file type rename: lost dir entry msdosfs_rename: updating .. in root directory? msdosfs_strategy: spec tag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed
nfsvinval nfs_doio: type %x unexpected
nfsbioread: type %x unexpected
ifupdown: socreate, error=%d
ifupdown: GIFFLAGS, error=%d
ifupdown: SIFFLAGS, error=%d
nfsbif setaddress: socreate, error=%d
setaddress, error=%d
nfsbtd nfs_boot: '%s' not found
setmtu: socreate, error=%d
setmtu: GIFMTU, error=%d
setmtu: SIFMTU, error=%d
deladdress: socreate, error=%d
deladdress, error=%d
nfs_boot: timeout...
nfs_boot: sosend: %d
nfs sndunlock short receive (%lu/%lu) from nfs server %s
impossible packet length %s (%d) from nfs server %s
short receive (%lu/%d) from nfs server %s
Egad!!
receive error %d from nfs server %s
nfsreply nil is alive again nfstrylater mtime ctime %s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u)
%s: re-enabling wcc
nfsiod nfsio nfsiorm nfsauth1 nfsauth2 nfskqpw nfskqpoll nfskqdet %s: vp=%p error=%d
nfsnodepl nfsvapl nfssilly nfs_node_init nfs send error %d for %s
nfsd send error %d
timer start timer stop nfscon sotype nfscn2 nfs rcvunlock Bad kerb verifier
Not fullname kerb verifier
Kerb nickname short
Kerb nick verifier bad
nfs server %s: %s
not responding nfsrvdescpl build > MLEN nfsumnt nfsstats iothreads nfs_vfsops: nfs_statvfs would lose buffers
nfs_args: retrying connect
nfscn3 nfsrcv nfssnd nfsaio nfsdis nfs%u nfs_mountroot: mget soname for %s nfs_mountroot: mount %s failed: %d
root on %s
nfs_mountroot: getattr for root nfs_readdir: lost in space nfs physio/async tag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %p nfsmblk nfs: sillyrename dir .nfsAxxxx4.4 nfs_remove: bad v_usecount %s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d %s: block not in map: bno=%d, fs=%s %s: map corrupted: cg=%d, irotor=%d, fs=%s %s: block not in map: fs=%s %s: freeing free block: dev = 0x%llx, block = %lld, fs = %s %s: freeing free frag: dev = 0x%llx, block = %lld, fs = %s uid %d, pid %d, command %s, on %s: %s
%s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s %s: bad block %lld, ino %llu
bad block ifree: dev = 0x%llx, ino = %llu, fs = %s
%s: freeing free inode file system full
%s: write failed, file system is full
out of inodes
%s: create/symlink failed, no inodes free
trimwq trimwqcv ffs_discarddata drain timeout
%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s %s: bad blockno %#llx != %#llx %s: optimization changed from SPACE to TIME
%s: optimization changed from TIME to SPACE
%s: bad optim: dev = 0x%llx, optim = %d, fs = %s %s: range: dev = 0x%llx, ino = %llu, fs = %s ffs_balloc: blk too big Could not unwind indirect block, error %d ffs_indirtrunc: bad buffer size itrunc: newspace snapblkfree: inconsistent block type ffs_snapshot_mount: vget failed %d
ffs_snapshot_mount: non-snapshot inode %d
ffs_snapshot_mount: read_1 failed %d
ffs_snapshot_mount: read_2 failed %d
ffs_snapshot_mount: %llu already on list ffs_isblock: unknown fs_fragshift %d ffs_isfreeblock: unknown fs_fragshift %d ffs_clrblock: unknown fs_fragshift %d ffs_setblock: unknown fs_fragshift %d %s: dup alloc ino=%lld on %s: mode %x/%x gen %x/%x size %llx blocks %llx %s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx
%s: dirty filesystem? ffs doclusterread doclusterwrite doreallocblks log_changeopt org.netbsd.kauth.system ffs_modcmd: can't listen on system scope.
appleufs ffsino ffsdino1 ffsdino2 , not mounting %s: dirty1 %s: unknown ufs flags: 0x%08x%s
%s: dirty2 %s: options QUOTA2 not enabled%s
%s: file system not clean (fs_clean=%#x); please fsck(8)
%s: lost blocks %lld files %d
%s: `-o softdep' is no longer supported, consider `-o log'
%s: rofs mod, fs=%s mfsidl mfs mfs_root mfs_ioctl not VBLK tag VT_MFS, pid %d, base %p, size %ld
mfs_inactive: not inactive (mfs_buflist %p) mfs_strategy: bad dev warning: mfs read during shutdown
mfs_close mfs_initminiroot() called more than once %s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d
%s: bad dir ino %ju at offset %d: %s
missing NUL in name not rounded null entry i_size too small %s: too big %s: nospace %s: newblk hard-linked directory ufsdir ufs_whiteout: unknown op ufs_strategy: spec tag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d
mode 0%o, owner %d, group %d, size %qd invalid uio rw: %d amappl cownow cownowpage anonpl livelock uao_getpage uao_get uao_create: hashinit swhash failed uao_create: swslots allocation failed uaoeltpl uao_flush: strange, got an out of range flush (fixed)
uao_put %s: impossible uao_det ubc_fault ubc_init: failed to allocate ubc_map ubc_init: failed to map ubc_object ubc_alloc %s: error=%d
udv_detach udv_fault udv_attach flt_noram5 flt_pmfail1 flt_pmfail2 anonget1 anonget2 flt_noram1 fltamapcopy fltagain1 flt_noram2 pgo_fault fltagain2 flt_noram4 uvm_fault_unwire_locked: address not in map uarea uvm uvm_init: page size not set uvm_km_bootstrap: could not reserve space for kernel uvm_km_bootstrap: could not reserve kernel kmem %s: unable to allocate space in parent map uvm_km_suballoc: submap allocation failed km_pgrm km_getwait2 plpg loanagain loanzero loanuopg user_va0_disable vmmpepl vmsppl vm_map %s: kernel object %p %p
%s: process wants to map virtual address 0; see vm.user_va0_disable in sysctl(7).
vmmeter loadavg uvmexp uvmexp2 maxslp uspace idlezero minaddress maxaddress thread_guard_size uobjwirepg uvm_setpagesize: page size %u (%#x) not a power of two uvm_page_physget: called _after_ bootstrap uvm_pageboot_alloc: out of virtual space uvm_pageboot_alloc: pmap_growkernel() failed uvm_pageboot_alloc: out of memory uvm_page_bootstrap: no memory pre-allocated uvm_pagealloc_strat: bad strat %d emergva pager_map pagedaemon: deadlock detected!
fork pooldrain pgdaemon anonmin filemin execmin anonmax filemax execmax inactivepct pdpolicy reactanon reactfile reactexec pglalloc Tried to add RAM after uvm_page_init uvm_page_physget: out of memory! uvm_page_physload: page size not set! uvm_page_physload: unable to load physical memory segment
%d segments allocated, ignoring 0x%llx -> 0x%llx
increase VM_PHYSSEG_MAX
Boot time slab Hotplug slab %s: unload attempted after uvm_page_init()
uvm_page_physload: bad free list %d uvm_page_physload: start >= end uvm_physseg_plug() failed at boot. %s: Tried to unplug from unknown offset
%s: Tried to unplug oversized span
%s: can't unplug() from the middle of a segment without UVM_HOTPLUG
%s: Tried to unplug unknown range
ractx %s: swapdev not in list %s: vnode type 0x%x %s: swap to sparse file %s: can't get vnode for swap device %s: can't lock swap device %s: can't open swap device swapmap %s: vmem_create failed swp vnx swp vnd swapctl: miniroot copy failed swapctl: copystr swap_on: miniroot larger than swap? swap_on: unable to preserve miniroot Preserved %d pages of miniroot leaving %d pages of swap
swapdrum_add swapiod %s: workqueue_create failed turning of swap... stopping swap on %s failed with error %d
uvn_fp1 uvn_fp2 copy-cred-on-fork bufq_disksort bufq_fcfs NetBSD-CORE %s@%d ELF exec_elf32 #! exec_script vmcmd kills extends calls /dev/console warning: no /dev/console
warning: lookup /dev/console: error %d
init: couldn't allocate argument space init path (default %s) halt reboot use absolute path, "halt", or "reboot"
/sbin/init init: trying %s
exec %s: error %d
copyout %d Detecting hardware... fork init cannot mount root, error = %d
fork pagedaemon ioflush fork syncer fork aiodoned %s %s (%s) /sbin/oinit /sbin/init.bak /rescue/init maxvnodes maxproc maxfiles argmax hostid profiling posix1version ngroups job_control saved_ids boothowto boottime maxpartitions timex rtc_offset ipc sysvmsg sysvsem sysvshm synchronized_io iov_max mapped_files memlock memlock_range memory_protection login_name_max defcorename logsigexit fscale ccpu cp_time maxphys monotonic_clock labelsector labeloffset labelusesmbr forkfsleep posix_threads posix_semaphores posix_barriers posix_timers posix_spin_locks posix_reader_writer_locks dump_on_panic root_partition drivers cp_id coredump setid owner group no_sa_support configname buildinfo messages usermem cnmagic usermem64 ostype osrelease osrevision hostname domainname rawpartition model machine ncpu byteorder physmem pagesize alignbytes physmem64 ncpuonline kern vfs hw ddb vendor security Accounting resumed
Accounting suspended
Accounting started
Accounting terminated
actwat acctwatch Accounting: write failed %d
kcredpl org.netbsd.kauth.cred org.netbsd.kauth.generic org.netbsd.kauth.process org.netbsd.kauth.network org.netbsd.kauth.machdep org.netbsd.kauth.device org.netbsd.kauth.vnode hardscheddiv clockrate hardclock_ticks clockinterrupt Condition variable %.*s pid %d (%s): %s write of %zu@%p at %lld failed: %d
cpu%d fdclose increase kern.maxfiles or MAXFILES fdfile filedesc file2 dup2 EVFILT_READ EVFILT_WRITE EVFILT_AIO EVFILT_VNODE EVFILT_PROC EVFILT_SIGNAL EVFILT_TIMER execargs should not happen pspawn lwpwait kernel mapping failed %d
netbsd init died (signal %d, exit %d) orphaned traced process increase kern.maxproc or NPROC forkmx forkulim idle/%u create_idle_lwp: error %d %s: WARNING: powerhook_establish is deprecated
dopowerhooks %s: %s (%p)
dopowerhooks: %s done
softresume softsuspend softstandby kthrwait unnamed WARNING: kthread `%s' (%d) exits with status %d
kthread_exit curcpu holds : %18d wanted by: %#018lx
softint pserialize %s: %s caller=%p Kernel lock lwppl maxlwp sigwait vfork (zombie) swapper WARNING: module error: %s: can't find builtin dependency `%s' %s: too many required modules %d >= %d builtin module `%s' failed to init, error %d link_set_modules `link_set_modules' section not present, error %d `link_set_modules' section wrong size %zu != %zu DEBUG: module: TRUE FALSE unload requested for '%s' (%s) module `%s' not found module `%s' busy (%d refs) cannot unload built-in secmodel module `%s' cannot unload module `%s' error=%d unloaded module `%s' module `%s' declined to be auto-unloaded error=%d %s: builtin module "%s" init failed: %d mod_unld /stand/%s/%d.%d/modules builtin %s failed: %d
module autotime modunload %s: %d %s: gone module `%s' pushed by boot loader already exists duplicate bootlist entry for module `%s' unable to load `%s' pushed by boot loader, error %d unable to fetch_info for `%s' pushed by boot loader, error %d dependent recursion too deep for `%s' %d > %d use -f to reinstate builtin module `%s' %s module `%s' already loaded out of memory for `%s' cannot fetch info for `%s', error %d module `%s' built for `%d', system `%d' forced load, system may be unstable incompatible module class for `%s' (%d != %d) dependency name mismatch (`%s' != `%s') module with name `%s' already loaded circular dependency detected for `%s' required module name `%s' longer than %d self-dependency detected for `%s' recursive load failed for `%s' (`%s' required), error %d unable to affix module `%s', error %d module properties failed for %s modcmd function failed for `%s', error %d recursive load causes duplicate module `%s' module `%s' loaded successfully Loading module from %s %s/%s/%s.kmod Cannot %sload kernel object `%s' error=%d .plist Loading plist from %s plist load returned error %d for `%s' noautoload autoloading is disallowed for %s kern.module.path=%s
owner field : %#018lx wait/spin: %16d/%d
locking against myself mutex_init: impossible type Mutex mutex physiod physio Devices without power management support: %s: %s is suspended by %s (delegator %s)
%s: %s-suspended by %s (delegator %s) already
%s: %s assumes %s-suspension by %s (delegator %s)
%s: newly %s-suspended by %s (delegator %s)
%s: %s suspension %s (delegator %s) removed by %s
class resume failed
Powering devices: (failed) Shutting down devices: shutting down %s, skipped. failed. success. %s-self %s: class suspend
%s: driver suspend
%s: bus suspend
%s: suspend enter
%s: suspend exit
Flushing disk caches: Suspending devices: %s: bus resume
%s: driver resume
%s: class resume
%s: resume enter
%s: resume exit
Resuming devices: %s: PMF event %d dropped (no memory)
%s: PMF event %d injected
Input idle handler called
pewpl pmfevent couldn't create pmfevent workqueue pmfsuspend couldn't create pmfsuspend workqueue procpl proc2 proc_args %s (pid %d) changing logname from %.*s to %s
ras plimitpl pstatspl curproc paxflags rlimit cputime filesize datasize stacksize coredumpsize memorylocked descriptors sbsize vmemoryuse stopfork stopexec stopexit rnd: source "%s" failed continuous-output test.
rnd: source "%s" failed statistical test. rnd: disabling source "%s".
rndsrc rndsample rnd: seeded with %d bits
printf autoconf rnd: bad seed length %d
rnd: bad seed checksum
requesting entropy from dead rndsink: %p rndsink %p in unknown state: %d rndsink destroying dead rndsink: %p cacheht_time balance_period average_weight min_catch timesoftints kpreempt_pri upreempt_pri runqueue pull runqueue push runqueue stay runqueue localize owner/count : %#018lx flags : %#018x
Reader / writer lock rwlock sigacts ksiginfo sorry, pid %d was killed: %s
sigexit 1 sigexit 2 sendsig: bad version %d
WARNING: softint_establish: table full, increase softint_bytes
softdis soft%s/%u softint_init_isr: error %d %s block/%u softint_init_cpu: cannot allocate memory bio softint_picklwp wedge: NAME= parsedisk use one of: %s[a-%c] none halt reboot
md0 (default %s dump device (default %sb) file system (default %s): use one of: generic unknown device major 0x%llx
%s%llu device %s (0x%llx) not configured
root on %s can't determine root device
swap dumps on %s Cannot open "md0" (root) sched_unsleep lbolt kpreempt defer: critical section defer: kernel_lock immediate setrunnable: lwp %p state was %d WARNING: negative runtime; monotonic clock has gone backwards
exceeded RLIMIT_CPU pid %d is killed: %s
pid %d, command %s, is killed: %s
/usr/src/sys/kern/kern_sysctl.c p->sysctl_child == NULL kernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version
sysctl_create: attempt to add node to aliased node %p
sysctl_destroy: rnode %p wrong version
%s: rnode %p wrong version
sysctl_query: rnode %p wrong version
sysctl_locate: pnode %p wrong version
sysctl_dispatch: rnode %p wrong version
sysctl_mmap: rnode %p wrong version
sysctl_createv: rnode NULL
sysctl_createv: sysctl_locate(%s) returned %d
sysctl: log %p root mismatch (%p)
sysctl_createv: sysctl_create(%s) returned %d
sysctl_create succeeded but node not found?!
sysctl_free: rnode %p wrong version
root %p left %d size %d content len %d: end
!!SYSCTL_NEEDFUNC!!
timecounter choice hardware timestepwarnings %s%s(q=%d, f=%lld Hz) timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u
timecounter: Timecounter "%s" frequency %ju Hz quality %d
tcdetach Time stepped from %lld.%09ld to %lld.%09ld
timecounter: Timecounters tick every %d.%03u msec
dummy ptimerpl ptimerspl nanoslp pid %d attempted to set the (obsolete) kernel time zone
callout_init_cpu (2) late/%u callout wait/%u tstilepl tstile turnstile_unsleep todr_attach: TOD already configured
WARNING: preposterous time in file system
WARNING: preposterous TOD clock time
WARNING: no TOD clock present
WARNING: clock lost %lld days
WARNING: clock gained %lld days
WARNING: using default initial time
WARNING: using filesystem time
WARNING: CHECK AND RESET THE DATE!
Cannot set TOD clock time
uidinfo proccnt lwpcnt lockcnt %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x rtts configure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %d %s with registered handlers %s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x
device-attach device-detach cfgmisc detachall configintr configroot %s: thread %x joined with error %d
config_devalloc: device name too long pmfsusp device-driver device-unit device-parent attribute-name loc-name locators interface-attributes config_detach: forced detach of %s failed (%d) config_defer: can't defer config of a root device config_attach: allocation of device softc failed Found %s (root) %s at %s WARNING: power management not supported
root device %s not configured
done.
WARNING: %d error%s while detecting hardware; check system log.
detaching %s, unable to detach instance
init rollback fini config_cfdata fini rollback failed fini rollback unsupported
blist_meta_alloc: allocation too large blst_radix_free: freeing free block blst_meta_free: freeing already free blocks (%llu) %llu/%llu blst_meta_free: freeing unexpected range blist_meta_fill: allocation too large blst_meta_fill: filling unexpected range bufq strategies bufq_alloc: sort out of range bufq_ bufq_alloc: no strategy callback cprng %s: reseeding with partial entropy
cprng %s: NIST Hash_DRBG reseed failed NIST Hash_DRBG failed self-test urandom arandom cprng %s: NIST Hash_DRBG instantiation failed cprng %s: creating with partial entropy
sysctl cprng %s: NIST Hash_DRBG failed ureadc: non-positive resid ureadc: non-positive iovcnt %s: block majors exhausted %s: character majors exhausted writ %s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld) no raw partition and partition table is full no raw partition and disk reports bad geometry sectors-per-unit sector-size sectors-per-track tracks-per-cylinder cylinders-per-unit disk-info %s: can't alloc vnode for %s %s: can't open dev %s (%d)
%s%d%c evcnt /dev/null set{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed
extent_print: NULL extent extent `%s' (0x%lx - 0x%lx), flags = 0x%x
0x%lx - 0x%lx
extent_free: start 0x%lx, end 0x%lx
extent_free: region not found hashdone: invalid table type KMGTPE kMGTPE %qu%s%c%s nointr disknames iostatnames iostats iostat_free: iostat_count == 0 ipi WARNING: ipi_register: table full, increase IPI_MAXREG
kcpuset kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS
kmem-2048 kmem-4096 kmem-8192 kmem-16384 kmem-8 kmem-16 kmem-24 kmem-32 kmem-40 kmem-48 kmem-56 kmem-64 kmem-80 kmem-96 kmem-112 kmem-128 kmem-160 kmem-192 kmem-224 kmem-256 kmem-320 kmem-384 kmem-448 kmem-512 kmem-768 kmem-1024 not modular %s error: %s,%zu: %s
lock address : %#018lx
current cpu : %18d
current lwp : %#018lx
lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %p klog msgbufsize msgbuf runonce percpu pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p)
pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p)
page %p, nmissing %d, time %u
%s: [%s] too large itemsperpage(%d) for PR_NOTOUCH poolbusy phpool-%d pcgnormal pcglarge pcache pcachecpu %s: [%s] page empty %s: [%s] page header missing Must specify a pool to print.
POOL CACHE POOL %s: size %u, align %u, ioff %u, roflags 0x%08x
alloc %p
minitems %u, minpages %u, maxpages %u, npages %u
itemsperpage %u, nitems %u, nout %u, hardlimit %u
nget %lu, nfail %lu, nput %lu
npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu
empty page list:
full page list:
partial-page list:
no current page
curpage %p
cpu layer hits %llu misses %llu
cache layer hits %llu misses %llu
cache layer entry uncontended %llu contended %llu
cache layer empty groups %u full groups %u
full cache groups:
group %p: avail %d
%p, 0x%llx
%p
empty cache groups:
(null) Skipping crash dump on recursive panic
panic: %s: table is full - %s
%s: table is full
exclusive access psrlz specificdata_domain_delete: not implemented specificdata_setspecific btalloc vmem %s-%zu vmem-va vmem-meta vmembt vmem_size vmem_rehash %s: workqueue_create %d
static_bt_inuse static_bt_count Invalid IPL: %d xclocv xchicv crosscall unicast xcall xcall/%u aio_process: invalid operation code
aiowork aiodone aio_jobs_pool aio_lio_pool posix_aio aio_listio_max aio_max sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s
mqmsgpl posix_msg mqueue mq_open_max mq_prio_max mq_max_msgsize mq_def_maxmsg mq_max_maxmsg mqsendcv mqrecvcv parked pset psets_max %d:1 ,%d:2 direct_select compat posix_sched pri_min pri_max ttyrub: would panic c = %d, val = %d
not a controlling terminal
no foreground process group
empty foreground process group
load: %d.%02d cmd: %s %d [ %#lx/%d %ld.%02ldu %ld.%02lds %d%% %ldk ttypause ttyraw ttyrawf ttycan ttycanf ttyout ttyoutf tkstat nin nout cancc rawcc qsize ttyldisc_init: termios_disc ttyldisc_init: ntty_disc termios ntty tablet slip ppp strip hdlc increase kern.maxptys putc: required clalloc
b_to_q: required clalloc
accf accf_ stream seqpacket dgram %s: source too long, %d < %d bytes unix: inet: inet6: link: atalk: (unknown socket family %d) bad family %hhu msize mclbytes nmbclusters mblowat mcllowat mbpl mclpl m_copydata: off %d, len %d m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d) m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d) m_copym: off %d, len %d m_copym: m == 0, off %d m_copym: m == 0, len %d [!COPYALL] m == NULL in m_pulldown() unix psem posix semmax semcnt ksem somaxkva sbmax sokva sopendfr bad initial sb_max value: %lu sopendfree soinit1 %d socket netio sbappendaddr sbappendaddrchain sbappendcontrol semi-panic: sbcompress
sbdrop(%p,%d): cc=%lu %s: message too large %d
mbsoname msgcontrol msghdr mbfree mbdata mbheader mbsopts mbftable mbcontrol mboobdata unp_thread unp_connect1 unp_disconnect1 uipc 1 uipc 2 unp_attach unpgc uipc_init %d uipc_usrreq uipc 4 buf mem pool index %d forcing bufcache %d -> 5 forcing bufcache %d -> 95 needbuf bufinit: cannot allocate submap biopl buf%uk buf%ub bufcache bufmem bufmem_lowater bufmem_hiwater bufinit2: can't establish soft interrupt bflush biolock biowait biodone2 already allocbuf: buffer larger than MAXBSIZE requested cachegc ncache nchinit %d namecache entries scanned entries collected over scan target under scan target forced reclaims namecache_stats cwdi dirhpl dirhepl dirhash memused maxmem dirhash_remove couldn't find entry in hash table
vfs_op_descs operation %s not listed in %s.
vfs_opv_init: bad operation vfs_opv_init: operation vector without default routine. fstypes magiclinks pnbufpl lf_findoverlap: default lockf chrooted pid %d uid %d (%s) detected outside of its chroot
namei_simple_convert_flags: bogus sflags
/../ earm zaurus kernel_ident ruid rgid Invalid nameiop
relookup: null name relookup: lookup on dot-dot %s: failed to start extattr: error = %d
syncing disks... vfs_mountroot: root device unknown vfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu) vfs_mountroot: rootdev not set for DV_DISK vfs_mountroot: can't get vnode for rootdev vfs_mountroot: can't open root device
%s: inappropriate for root file system
root file system type: %s
WARNING: No file system modules have been loaded.
Supported file systems: no file system for %s (dev 0x%llx) cannot find root vnode, error=%d mount: lost mount Unmounting fresh file system failed unmount: dangling vnode forcefully %sunmounted %s on %s type %s
unmount of %s failed with error %d
unmounting done
WARNING: some file systems would not unmount
unmounting file systems...
ILLEGAL vnode %p flags %s
%stag %s(%d) type %s(%d) mount %p typedata %p
%susecount %d writecount %d holdcount %d
%ssize %llx writesize %llx numoutput %d
%sdata %p lock %p
%sstate %s key(%p %zd) %slrulisthd %p
ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT
EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROP filedelay dirdelay metadelay vflushbuf: not dirty, bp %p vflushbuf: dirty ACTIVE MARKER LOADING LOADED BLOCKED RECLAIMING RECLAIMED VNON VREG VDIR VCHR VLNK VSOCK VFIFO VBAD VT_UFS VT_NFS VT_MFS VT_MSDOSFS VT_LFS VT_LOFS VT_FDESC VT_PORTAL VT_NULL VT_UMAP VT_KERNFS VT_PROCFS VT_AFS VT_ISOFS VT_UNION VT_ADOSFS VT_EXT2FS VT_CODA VT_FILECORE VT_NTFS VT_VFS VT_OVERLAY VT_SMBFS VT_PTYFS VT_TMPFS VT_UDF VT_SYSVBFS VT_PUFFS VT_HFS VT_EFS VT_ZFS VT_RUMP VT_NILFS VT_V7FS VT_CHFS symlink-target %s: failed to start extattr, error = %d %s: failed to stop extattr, error = %d fdesc kernfs afs fstchg fstcnt %s: cannot reclaim %s: bad ref count dead but not clean vcachepl vcache vdrain vdrainwt %s: holdcnt vp %p %s: cannot lock %s: neg numoutput, vp %p xattr-name xattr-val xattr-list system. user. security. trusted. vop_setextattr vop_deleteextattr vop_openextattr vop_listextattr vop_getextattr vop_closeextattr vop_putpages vop_getpages vop_whiteout vop_advlock vop_pathconf vop_islocked vop_print vop_strategy vop_bmap vop_unlock vop_lock vop_reclaim vop_inactive vop_abortop vop_readlink vop_readdir vop_symlink vop_rmdir vop_mkdir vop_rename vop_link vop_remove vop_seek vop_fsync vop_mmap vop_revoke vop_kqfilter vop_poll vop_fcntl vop_ioctl vop_fdiscard vop_fallocate vop_write vop_read vop_setattr vop_getattr vop_access vop_close vop_open vop_mknod vop_create vop_lookup vop_bwrite dead fs operation used dead tag VT_NON, dead vnode
fiford fifowr tag VT_NON , fifo with %d readers and %d writers /usr/src/sys/miscfs/genfs/genfs_io.c genput %s: bogus command %d genfs: bad op layerfs tag VT_LAYERFS, vp=%p, lowervp=%p
spec_ioctl spec_read type spec_write type spec_fdiscard: not a device
spec_close: spurious pgrp ref spec_close: not special dev %llu, %llu
spec_node_destroy: corrupt hash default label WARNING: %s: total sector size in disklabel (%ju) != the size of %s (%ju)
%s: %ju trailing sectors not covered by disklabel
WARNING: %s: end of partition `%c' exceeds the size of %s (%ju)
raidframe %s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu)
%s at %s (%s) deleted
dkdrn %s%u: unable to attach pseudo-device
%s at %s: "%s", %llu blocks at %lld, type: %s
WARNING: double match for wedge name %s (%s, %s)
wedge:%s dkwedge: unable to attach cfdriver dkwedge: unable to attach cfattach dk-method-%s: method "%s" already exists at priority %d
%s: unable to compute pdev, error = %d
%s: unable to find vnode for pdev, error = %d
%s: unable to lock vnode for pdev, error = %d
%s: unable to open device, error = %d
%s: unable to close device, error = %d
WARNING: double match for boot wedge (%s, %s)
APPLE_UNIX_SVR2 APPLE_HFS %s: wedge named '%s' already exists, manual intervention required
%s: error %d adding partition %s type %s
APPLE sysv hfs %s: GPT GUID: %s
%s: bogus GPT entry size: %u
%s: WARNING: clamping number of GPT entries to 512 (was %u)
%s: GPT block numbers out of range
%s: unable to read GPT partition array, error = %d
%s: bad GPT partition array CRC
%s: wedge named '%s' already existed, using '%s'
%s: error %d adding entry %u (%s), type %s
GPT ccd cgd mdidle %s: cfattach_attach failed
%d %llu %u urandom%u rndtemp rndctx rndpseudo open hard open soft bpf bpf_mcpy bpf_change_type %s: softint_establish() failed %s: no bpf_if found for %s maxbufsize peers bpfattach %s: bpf_setdlt: ifpromisc failed (%d)
bpf_filter bpfops %.*s/%hhu#%s link#%hu if_ ifq maxlen drops ifnet ifa sdl %s: could not attach sysctl nodes
sndq rcvq if_detach: WARNING: AF %d not purged
UP DOWN %s: lost link state change %s
too many interfaces %s: recursively called too many times(%d)
%s: m_tag_get() failed, recursion calls are not prevented.
invalid argument to %s %s: discarding oversize frame (len=%d)
%s: can't handle af%d
ether %s: invalid ifp (sdl_index %d)
llentrypl looutput: no header mbuf if_loop ifmedia_add: can't malloc entry ifmedia_set: no match for 0x%x/0x%x
ifmedia_set failed pfil pktqsync pktqrenq Mask for route not entered
rn_addmask: mask impossibly already in tree
Non-unique normal route, mask not entered
rn_delete: inconsistent annotation
rn_delete: Orphaned Mask %p at %p
rn_delete: couldn't find our annotation
rn_delete: couldn't find us
radix already initialized rn_init: radix functions require max_keylen be set
rn_init rn_init 2 delayed rn_inithead failed raw_usrreq rt_timer_timer: rtq_count reached 0
rtentry rt_free rt_update rtentpl rttmrpl rt_timer rt_timer_queue_remove_all: rtq_count reached 0
rt_timer_add: rtq_count reached 0
rt_timer_remove_all: rtq_count reached 0
%s: unable to delete rtentry @ %p, error = %d
rtfree 2 route_purgeif route_abort route_accept route rtable %s: message too long %s: queue full, dropped message
%s: unknown command %d keep log_movements log_permanent_modify log_wrong_iface log_unknown_network %s: %s not ready
arp from %s: addr len: new %d, i/f %d (ignored)
%s: arp: link address is broadcast for IP address %s!
%s: DAD duplicate address %s from %s
%s: DAD defended address %s from %s
%s: DAD ignoring duplicate address %s from %s
%s: DAD defence failed for %s from %s
%s tried to overwrite permanent arp info for %s
%s on %s tried to overwrite arp info for %s on %s
arp info overwritten for %s by %s
%s: called with non-tentative address %s(%s)
%s: memory allocation failed for %s(%s)
%s: called with duplicate address %s(%s)
%s: %s: ARP announcement complete for %s
%s: arp_setgate failed
%s: bad gateway value
%s: failed to %s llentry for %s on %s
%s: ouch, empty static llinfo for %s
arpintr revarp %s: mbuf %d too short for IP header %zu %s: offset %d too short for IP header %zu encapelem ip_encap cv %s_wqinput %s: could not create a sysctl node for %s
inputq is-root models Traditional NetBSD: Superuser org.netbsd.secmodel.suser suser_modcmd::init: secmodel_register returned %d
suser_modcmd::fini: secmodel_deregister returned %d
is-securelevel-above Traditional NetBSD: Securelevel org.netbsd.secmodel.securelevel securelevel_modcmd::init: secmodel_register returned %d
securelevel_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: Extensions org.netbsd.secmodel.extensions extensions_modcmd::init: secmodel_register returned %d
curtain usermount user_set_cpu_affinity extensions_modcmd::fini: secmodel_deregister returned %d
Traditional NetBSD: 4.4BSD org.netbsd.secmodel.bsd44 secmodel_bsd44_modcmd::init: secmodel_register returned %d
secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d
secmodel_bsd44 suser,securelevel,extensions crypto fss pps ptm drvctl tap veriexec fw ucycom utoppy bthub amr lockstat putter srt drm altmem twa cpuctl pad zfs tprof isv video hdaudio uhso rumpblk npf dtv filemon iscsi tpm mfi seeprom dtrace spiflash lua spkr hdmicec nvme ctty physcon ptc qms ofcons fd tun vidcconsole opms ipl ofrom scr fcom joy midi sequencer vcoda wsdisplay wsmouse usb uhid ulpt scsibus raid ugen ucom urio uscanner openfirm biconsdev isdn isdnctl isdnrchan isdntrc isdntel sacom mly wsfont agp pci iop altq mlx plcom clockctl irframe cir radio kttcp ixpcom sysmon dmoverio sscom ksyms isdnbchan epcom tslcd twe nsmb wdc pxapcic pxamci ziic sdmmcbus wsemuldisplaydev wskbddev drive channel kbdmux controller index dack irq intrbase %s: dir offset too large on fs %s (mounted from %s)
%s: dir offset too large for emulated program
/usr/libexec/ld.elf_so %s-%s Kernel RNG "%s" monobit test FAILURE: %d ones
Kernel RNG "%s" poker test failure: parameter X = %lld.%lld
Kernel RNG "%s" long run test FAILURE: Run of %d %ds found
Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d)
Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d)
%s: invalid base %d divide by 0 /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/subvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvsi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/negvdi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/mulvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvsi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/addvdi3.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvsi2.c /usr/src/sys/external/bsd/compiler_rt/dist/lib/builtins/absvdi2.c /usr/src/sys/lib/libkern/../../../common/lib/libppath/ppath.c p->p_refcnt != 0 unused v6 v7 v71k v8 other hpfs ados filecore ext2fs ntfs jfs2 vinum udf sysvbfs efs nilfs minixfs3 0%llo %s:%d: abort in %s string propstng < > & plist version="1.0" ?xml !DOCTYPE plist %s%s
SIOCDIFPHYADDR deletetunnel bad hexadecimal digits hexadecimal digits too long strings too long "%.*s" %s: getifaddrs address: %s: ioctl %s %s
SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ]
valid only with vlan(4) interfaces vlantag SIOCSETVLAN vlan: %d parent: %s
%s: getvlan -vlanif VLAN tag fatal signal: %s cannot get kernel security level: %m can't open %s: %m can't get %s for controlling terminal: %m cannot change kernel security level from %d to %d: %m /dev/constty /dev/console /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin can't exec `%s' for single user: %m can't fork single-user shell: %m, trying again wait for single-user shell failed: %m; restarting shell stopped, restarting single user shell terminated (%x), restarting ./MAKEDEV /etc/MAKEDEV initial setsid() failed setlogin() failed /dev -MM MAKEDEV exit status %d Unable to run MAKEDEV invalid major number invalid minor number too many fields for format usage: %s [-rR] [-F format] [-m mode] [-u user] [-g group]
[ name [b | c] [major | driver] minor
| name [b | c] major unit subunit
| name [b | c] number
| name p ]
%s -l [driver] ...
kern.drivers invalid format: %s %s: invalid group name %s: invalid user name lrRF:g:m:u: character major %d block major %d format is meaningless for fifos node type must be 'b', 'c' or 'p'. unknown driver: %s invalid number: %s %s: uid/gid not changed invalid unit number invalid subunit number 386bsd 4bsd bsdos freebsd hpux linux osf1 solaris sunos svr3 svr4 ultrix @ - 2 - &- -- @ d- 8- A- S- - :+ [- n- {- - - - - /N - @ - - . . @ <. ffs K > U. Z. c. h. l. t. x. %s,%s Usage: %s [-Aadfruvw] [-t type]
%s [-dfruvw] special | node
%s [-dfruvw] [-o options] [-t type] special node
%s on %s type %.*s %sunknown flag%s %#x %smounted by %sfsid: 0x%x/0x%x reads: sync %llu async %llu , writes: sync %llu async %llu getargs , [%s: %s] realpath `%s' union puffs| %s on %s type %.*s: %s
already mounted force mount_puffs rump rump_%s exec: Cannot create pipe Cannot open fd to mount program exec %s for %s: %s statvfs %s Only one -t option may be specified. Aadfo:rwt:uv from_mount Unknown file system %s Unknown special file or file system `%s' Unknown file system type for `%s' :@ WARNING: autoselecting nfs based on : or @ in the device name is deprecated!
WARNING: This behaviour will be removed in a future release
asynchronous extattr hidden nocoredump relatime soft dependencies symperm exported read-only NFS exported exported to the world anon uid mapping kerberos uid mapping non-reserved ports WebNFS exports with quotas root file system being updated reload filesystem data force unmount or readonly change retrieve mount arguments ados filecore ntfs udf sysvbfs efs nilfs strdup 0 0 k u /- A2 0 :+ &- S- + + @ 0 0 0 0 0 0 0 0 b norrip bgens bextatt bnojoliet bnocasetrans brrcaseins usage: %s [-o options] special node
getmntopts egijo:r %s on %s userquota groupquota rdonly extatt gens maplcase casetrans nrr rrip joliet rrcaseins Warning: realpath %s "%s" is a non-resolved or relative path. using "%s" instead. 0 0 k u /- A2 0 :+ &- S- + @ X ;- @ o+ Z3 + @ - 2 o: mount table full incorrect super block specified device does not match mounted device %s on %s: %s softdep 0 0 k u /- A2 0 :+ &- S- + @ + @ b shortname blongname bnowin95 bgemdosfs bmntversioned butf8 b ronly b waitonfat b fatmirror usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options]
[-t gmtoff] [-u uid] special mountpath
Gsl9Uu:g:m:M:o:t: stat %s uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s
unknown %s id: %s invalid file mode: %s 0 0 k u /- A2 0 :+ &- S- + o+ + @ ~ < < < < @ < '< /< 5< :< >< 8 @ [: a: D< j: t: ~: : @ b soft bwsize brsize btimeo bretrans bmaxgrps bintr bnoconn bnqnfs b nfsv3 b
kerb b dumbtimr b leaseterm b
readahead bdeadthresh bresvport brdirplus breaddirsize bxlatecookie bnoac [-23bCcdilPpqsTUX] [-a maxreadahead] [-D deadthresh] usage: %s %s
%s
%s
%s
%s
rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm] conflicting version options illegal -a value -- %s illegal -D value -- %s illegal -I value -- %s wsize rdirsize leaseterm readahead deadthresh timeo retrans illegal -R value -- %s illegal -r value -- %s illegal -t value -- %s illegal -w value -- %s illegal -x value -- %s 23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UX getnameinfo: %s sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d
addr=%s, port=%s, addrlen=%d, conn dumbtimer nfsv3 rdirplus mntudp resport nqnfs soft tcp nfsv2 maxgrps Unsupported socket family %d recvrpc: reject, astat=%d, errno=%d
getport: %s callrpc: error = %d
sendrecv: short write! (%zd < %zu) no : or @ spec can't get net id for host "%s": %s D E 4.3BSD, 1 => FFSv1, 2 => FFSv2 -S secsize sector size -T disktype disk type -V verbose output verbosity: 0 ==> none, 4 ==> max -Z pre-zero the image file -a maxcontig maximum contiguous blocks -b bsize block size -d maxbsize maximum extent size -e maxbpg maximum blocks per file in a cylinder group -f fsize frag size -g avgfilesize average file size -g groupname group name of mount point -h avgfpdir average files per directory -i density number of bytes per inode -m minfree minimum free space % -n inodes number of inodes (overrides -i density) -o optim optimization preference (`space' or `time') -q (user|group) enable specified quota -p perm permissions (in octal) -s fssize file system size (sectors) -u username user name of mount point -v volname Apple UFS volume name rdfs: read error for sector %lld: %s
setblock bad fs_fragshift %d
wtfs: write error for sector %lld: %s
cg 0: bad magic number fsinit: inode value out of range (%llu).
isblock bad fs_fragshift %d
internal error: can't find block in cyl 0 clrblock bad fs_fragshift %d
first cylinder group ran out of space illegal expected average file size %d
illegal expected number of files per directory %d
block size must be a power of 2, not %d
fragment size must be a power of 2, not %d
fragment size %d is too small, minimum is %d
block size %d is too small, minimum is %d
block size %d is too large, maximum is %d
block size (%d) cannot be smaller than fragment size (%d)
Maxcontig raised to %d
fragment size %d is too small, minimum with block size %d is %d
ilog2: %d is not a power of 2 Too many fragments (0x%llx) for a FFSv1 filesystem
Filesystem size %lld < minimum size of %d
CGSIZE miscalculated %d > %d
%s: %.1fMB (%lld sectors) block size %d, fragment size %d
using %d cylinder groups of %.2fMB, %d blks, %d inodes.
Cannot allocate I/O buffer preposterous size %lld
super-block backups (for fsck_ffs -b #) at:
Too many cylinder groups to fit summary information into first cylinder group Panic: cylinder group too big %s%*llu, Error making filesystem No space for superblock usage:
%s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval]
[-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host
Cannot resolve "%s" (%s) %s only supported with IP
Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s
TCP: from port %u, to port %u
UDP: from port %u, to port %u
ID=%u icmp_seq=%u for icmp_seq=%u blocksignals: sigprocmask 0.0.0.0
----%s PING Statistics----
%d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets! %.1f%% packet loss round-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms
%.1f packets/sec sent, %.1f packets/sec received
Can't turn off special IP header failed to clear cached route Can't set special IP header sendto wrote %s %d chars, ret=%d %d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms Cannot create socket Cannot shutdown for read setuid Bad/invalid number of packets: %s Bad/invalid interval: %s Timing interval %g too large Bad/invalid preload value: %s Only one of -P and -p allowed Bad/invalid packet size: %s packet size is too large bad tos value: %s ttl out of range: %s -g Bad/invalid maxwait time: %s ac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw: Must be superuser to use -f Must be superuser to use < 1 sec ping interval Must be superuser to use -l Packet interval must be at least 1 ns Sorry, no audible output for flood pings Can't allocate %d bytes "-p %s": patterns must be specified with 1-32 hex digits
%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x PATTERN: 0x Can't turn on socket debugging SO_DONTROUTE Can't disable multicast loopback Can't set multicast time-to-live Can't set multicast source interface Can't set source interface/address PING %s (%s): %d data bytes
Cannot set the receive buffer size enablesignals: sigprocmask poll recvfrom packet too short (%d bytes) from %s
remote host does not support record route
remote host does not support source route
wrong total length %d instead of %d [*** sequence gap of %u packets from %u ... %u ***]
wrong data byte #%d should have been %#x but was %#x Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set. Next MTU=%d Source Route Failed Unreachable unknown net Unreachable unknown host Unreachable host isolated Net prohibited access Host prohibited access Bad TOS for net Bad TOS for host Communication prohibited Host precedence violation Precedence cutoff Bad Destination Unreachable Code: %d Source Quench Redirect Network Redirect Host Redirect Type of Service and Network Redirect Type of Service and Host Redirect--Bad Code: %d New router addr: %s Echo Request: ID=%d seq=%d Router Discovery Advert Router Discovery Solicit Time To Live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Address Mask Request Address Mask Reply Bad ICMP type: %d
LSRR: (same route)
RR:
NOP
unknown option 0x%x usage: %s [-dln%sqvxz] [-- ]
(can't restart init): poweroff dlnpqvxz halted by %s powered off by %s rebooted by %s: %s rebooted by %s SIGTSTP init SIGTERM all processes SIGKILL all processes WARNING: some process(es) wouldn't die reboot() /x 3x 8x usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno]
%s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file]
[-s fileno] [file ...]
%s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file]
[-M mtreefile] [-s fileno] [file ...]
option requires an argument -- %c illegal blocksize -- %s block size must be greater than 0 unknown digest algorithm: %s %c and %c options are mutually exclusive can't open %s illegal dump number -- %s dump number must be greater than 0 b:cD:df:himM:NRrs:tuvxy none of i, R, r, t or x options specified Begin incremental restore
./restoresymtable Calculate node updates.
Begin level 0 restore
Calculate extraction list.
Verify the directory structure
command lines cannot be continued
missing %c
Warning: undefined file type %d
%s > %s: %s: no filename match.
glob() aborted.
unknown error!
%s: not a directory
%s: not on extraction list
ls [arg] - list directory
Available commands are:
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used
If no `arg' is supplied, the current Debug - turn on debugging
help or `?' - print this list
(useful with ``ls'')
verbose - toggle verbose flag what - list dump header information
quit or xit - immediately exit program
setmodes - set modes of requested directories
extract - extract requested files
list of files to be extracted
delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory
cd arg - change directory
ls: out of memory
directory reopen failed
%s%s: name exceeds %d char
/
verbose mode off
verbose mode on
setmodes what Debug debugging mode off
debugging mode on
%s: unknown command; type ? for help
restore interrupted, continue |NIL |ONTAPE |INOFND |NAMEFND |MODECHG dir %10llu %s
%s: not on the tape
./%llu Mark entries to be removed.
Delete whiteouts
%s: REMOVE
corrupted symbol table
name/inode conflict, mktempname %s
[%s] %s: %s
deleted hard link %s to directory %s
[%s] %s: %s|LINK
cannot KEEP and change modes NODE and LEAF links to same inode [%s] %s: Extraneous name
%s: (inode %llu) not found on tape
[%s] %s: inconsistent state
[%s] %s: impossible state
Find unreferenced names.
%s: remove unreferenced name
unreferenced with flags Remove old nodes (directories).
cannot remove, non-empty Continue extraction of new leaves
Extract new leaves.
%llu: bad first
%s: not found on tape
expected next file %llu, got %llu
unknown file on tape
unexpected file on tape Extract requested files
Add whiteouts
Add links
Check the symbol table.
incomplete operations Warning: missing name %s
type should be LEAF missing inumber %llu
Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d
Extract directories from tape
%s/rstdir%d %s/rstdir%d-XXXXXX cannot mkstemp temporary file %s cannot open temporary file %s %s/rstmode%d %s/rstmode%d-XXXXXX opendirfile: %s
Root directory is not on tape
no memory directory table
error reading directory
corrupted directory: bad reclen %d
corrupted directory: bad inum %d
%s/ Warning: `.' missing from directory %s
Warning: `..' missing from directory %s
%s%s: name exceeds %lu char
Set directory mode, owner, and times.
modefile not defined
directory mode, owner, and times not set
fopen: %s
cannot open mode file %s
cannot find directory inode %llu
error setting directory modes
Cannot find directory inode %llu named %s
write error extracting inode %llu, name %s
read: %s
cannot find entry in parent list addino: out of range %llu
duplicate inum deleteino: out of range %llu
deleteino: %llu not found
%s is not a directory
%s: pathname too long
bad name
no space for string table
no memory to extend symbol table
bad name to addentry %s
link to non-existent name
duplicate entry
not marked REMOVED freeing referenced directory freeing non-empty directory lookupino failed link not found cannot move ROOT Checkpointing the restore
cannot create save file %s for symbol table
fwrite: %s
output error to file %s writing symbol table
Initialize symbol table.
no memory for entry table
cannot open symbol table file %s
stat: %s
cannot stat symbol table file %s
cannot allocate space for symbol table
cannot read symbol table file %s
Incremental tape too low
Incremental tape too high
initsymtable called from command %c
Checksum error %o, inode %llu file %s
unallocated block in symbolic link %s
symbolic link name: %s->%s%s; too long %d
Cannot have multiple dumps on pipe input
ioctl MTFSF: %s
seek error extracting inode %llu, name %s
lseek: %s
End-of-input encountered while extracting Warning: %s %s
write error extracting inode %llu, name %s
write: %s
Cannot allocate space for tape buffer
cannot open %s: %s
the epoch
[unknown] #Dump date: %s #Dumped from: %s #Level %d dump of %s on %s:%s
#Label: %s
/set uname=root gname=wheel
error writing to mtree file Changing volumes on pipe input?
Unless you know which volume your You have not read any tapes yet.
towards the first.
with the last volume and work file(s) are on you should start
(Use 1 for the first volume/tape, etc.)
You have read volumes Specify next volume #: Volume numbers are positive numerics
Mount tape volume %d
Enter ``none'' if there are no more tapes
otherwise enter tape name (default: %s) Cannot open %s
header read failed at %d blocks
tape is not dump tape
Volume mismatch: expecting %d, tape header claims it is %d
Wrong dump date
got: %s wanted: %s read %ld recs, tape starts with %ld
Skipping %d duplicate record%s.
active file into volume 1
mid-media short read error.
partial block read: %d should be %d
Tape read error while trying to set up tape
trying to resynchronize
restoring %s
skipping over inode %llu
continuation failed: %s
End-of-tape encountered
Note: Doing Byte swapping
gethead: unknown inode type %d
Volume header (%s inode format) begins with record %lld Dumped inodes map header Used inodes map header File header, ino %llu File continuation header, ino %llu End of tape header ; predicted %ld blocks, got %ld blocks unexpected tape header
unknown tape header type %d
resync restore, skipped %ld blocks
ran off end of tape
not at beginning of a file
Missing address (header) block for %s at %d blocks
%s: unknown file mode 0%o
skipped socket %s
unextracted directory %s
extract file %s
%s: zero length symbolic link (ignored)
extract special file %s
%s: cannot create special file: %s
extract fifo %s
%s: cannot create fifo: %s
fifo %s: cannot create file: %s
%s (%s) = %s
no memory for %s
%s: inconsistent map size
%s: map size changed
Verify tape and initialize maps
tape read error: %s
is not a multiple of dump block size Tape block size (%ld) %s (%ld)
Tape block size is %d
Tape is not a dump tape
Converting to new file system format.
cannot stat .: %s
bad block size %d
Tape is not volume 1 of the dump
no header after volume mark!
Cannot find file removal list
MD5 SHA1 RMD160 warning: cannot rename %s to %s: %s
rename %s to %s
warning: cannot create whiteout %s: %s
Create whiteout %s
|REMOVED |TMPNAME |EXTRACT |NEW |KEEP |EXISTED %s is not on the tape
dump core symbolic hard warning: cannot create symbolic link %s->%s: %s
warning: cannot create hard link %s->%s: %s
linkit: unknown type %d
Create %s link %s->%s
bad entry: %s
parent name %s
sibling name: %s
next entry name: %s
next link name: %s
next hashchain name: %s
entry type: %s
inode number: %ld
flags: %s
RSTTMP %s%ld%llu not on ino list mktempname: called with TMPNAME newnode: not a node warning: %s: %s
Make node %s
removenode: not a node removenode: non-empty directory Remove node %s
removeleaf: not a leaf Remove leaf %s
delwhiteout: not a leaf warning: cannot delete whiteout %s: %s
Delete whiteout %s
%s type=%s uid=%d gid=%d mode=%#4.4o flags= nodump %suchg %suappnd %sopaque %sarch %sschg %ssappnd Lost connection to remote host. Protocol to remote tape server botched.
(rmtgets got "%s").
Protocol to remote tape server botched (code "%s").
shell/tcp: unknown service who are you? invalid user name: %s /etc/rmt O%s
%d
C
R%d
W%d
L%d
%d
I%d
%d
DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG y ҄ = e Ņ # K s UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PROMISC
ALLMULTI OACTIVE SIMPLEX
LINK0LINK1LINK2MULTICAST UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED
XRESOLVE LLINFO STATIC
BLACKHOLECLONEDPROTO2PROTO1LOCALBROADCAST pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtu dfLnqSsTtv U G H R B D M @ d m C L S 1 @ 2 p l b 0123456789abcdef atalk hopcount inet6 lockrest nostatic proto1 proto2 recvpipe rtt rttvar sendpipe show ssthresh x25 xns flushall nocloning noconnected noblackhole noreject mpls %s: inet %s; %s: link %s; %s: (%d) %s; not in table entry in use routing table overflow prefixlen is not supported with af %d %s: bad value
sockaddrs: routing message version %d not understood
#%d: len %d, if# %d, %s, flags: pid %d, metric %d, flags: if# %d, what: re-associate disassociate scan complete join michael replay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llx arrival pid %d, seq %d, errno %d, flags:
locks: inits: route-sysctl-estimate actual retrieval of routing table Examining routing table from sysctl (address family %s)
write to routing socket, got %d for rlen %-20.20s writing to routing socket: %s botched keyword: %s Usage: %s [-%s] cmd [[-] args]
Internal Error Cannot allocate memory assuming route to if old usage of trailing 0 assuming route via gateway old usage of trailing digit missing destination specification missing gateway specification -host and -net conflict soup->so_dst soup->so_gate soup->so_mask soup->so_genmask soup->so_ifp soup->so_ifa : gateway %s RTM_ADD: Add Route RTM_DELETE: Delete Route RTM_CHANGE: Change Metrics, Flags or Gateway RTM_GET: Report Metrics RTM_LOSING: Kernel Suspects Partitioning RTM_REDIRECT: Told to use different route RTM_MISS: Lookup failed on this address RTM_LOCK: fix specified metrics RTM_OLDADD: caused by SIOCADDRT RTM_OLDDEL: caused by SIOCDELRT RTM_OOIFINFO: iface status change (pre-1.5) RTM_OIFINFO: iface status change (pre-64bit time) RTM_IFANNOUNCE: iface arrival/departure RTM_IEEE80211: IEEE80211 wireless event RTM_IFINFO: iface status change RTM_NEWADDR: address being added to iface RTM_DELADDR: address being removed from iface RTM_CHGADDR: address being changed on iface link#%d %-*.*s %-*.*s %-6.6s
Flags AppleTalk Encap Internet
Protocol Family %d:
%-6.6s %u.%u.%u.%u/%d (%d) %s af %d: %s sysctl of routing table Routing tables %6s %8s unspec PF PF 0* X X X , , x < < Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -]
illegal time format FINAL /usr/bin/wall %s -n %s: Can't find `%s' (%m) *** %sSystem shutdown message from %s@%s ***
System going down at %5.5s
System going down in %ld minute%s
System going down in 30 seconds
System going down IMMEDIATELY
/etc/nologin
NO LOGINS: System going down at /sbin/reboot /sbin/halt %s: Not super-user b:Ddfhknprvxz Incompatible options -f and -n Incompatible options -%s and -r now TZ time is already past Shutdown at %.24s.
Shutdown NOW! shutdown: fork shutdown: [pid %d]
%s by %s: %s
System shutdown time has arrived
but you'll have to do it yourself
/fastboot fastboot file for fsck
About to run shutdown hooks...
. /etc/rc.shutdown
Done running shutdown hooks.
-v -z -d Can't exec `%s' (%m) Can't exec `%s' hw.disknames usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto]
%s -a [-p priority] path
%s -q
%s -c -p priority path
%s -D dumpdev|none
%s -d path
%s -l | -s [-k|-m|-g|-h]
%s -U [-n] [-t blk|noblk|auto]
%s -z
could not set dump device to %s %s: setting dump device to %s
WARNING: %s is readable by the world WARNING: %s is writable by the world %s: adding %s as swap device at priority 0
%s: removing %s as swap device
%s%s%c sw priority= nfsmntpt= empty mountpoint /sbin/mount_nfs %s: mount failed /sbin/umount noblk %s: adding %s as swap device at priority %d
%s: failed to add %s as swap device
%s: failed to remove %s as swap device
%s: umount failed swapon usage: %s -a [-t blk|noblk]
%s ...
ADUacdfghklmnop:qst:z could not get dump device no dump device set dump device is major %llu minor %llu
%s: there are swap or dump devices defined in /etc/fstab
%s: no swap or dump devices in /etc/fstab
KBytes MBytes GBytes no swap devices configured SWAP_STATS SWAP_STATS different to SWAP_NSWAP (%d != %d) Device %-*s %*s %8s %8s %8s %s
Priority Capacity Avail Used %-*s %*ld %8ld %8ld %5.0f%% %d
%-*s %*s %8s %8s %5.0f%% %d
%s/%s swap space
%ld/%ld %s swap space
total: %s allocated, %s used, %s available.
total: %ld %s allocated, %ld %s used, %ld %s available
Total %-*s %*s %8s %8s %5.0f%%
%-*s %*ld %8ld %8ld %5.0f%%
Usage: %s [-fR] special | node
%s: not currently mounted umount_%s %s: execvp fR C e 8
*************************************************************************************************************************************************************************************************************************************** TYPE %s %s TYPE %s %s: unknown mode.
Continue with %s %s [anpqy?]? %s; %s aborted
Prompting off for duration of %s.
Interactive mode: off.
confirmation options:
a answer `yes' for the duration of %s
n answer `no' for this file
p turn off `prompt' mode
q stop the current %s
y answer `yes' for this file
? this help list
nmap: unbalanced brackets.
Using %s mode to transfer files.
changetype: unknown type %d binary tenex We only support %s mode, sorry.
We only support %s format, sorry.
We only support %s structure, sorry.
STOR APPE STOU local-file remote-file local-files Glob pattern `%s' not found Restart is not supported by the remote server.
RETR r+ remote-files mreget Skipping non-relative filename `%s'
Can't open source file %s
20150912 NetBSD-ftp Version: %s %s
%s %s.
Bell mode Editing support not compiled in; ignoring command.
Packet tracing mark: bad bytecount value `%s'.
Hash mark printing %s (%d bytes/hash mark) Verbose mode Use of PORT/LPRT cmds Progress bar Interactive mode (none) Disabling gate-ftp mode - no gate-ftp server defined.
Gate ftp: %s, server %s, port %s.
Globbing Preserve modification times %s: bad debugging value.
Debugging %s (ftp_debug=%d).
remote-directory CWD command not recognized, trying XCWD.
XCWD %s Can't chdir `%s' Local directory now: %s
Unable to determine local directory
DELE %s from-name to-name RNFR %s RNTO %s MLSD NLST MLSD is not supported by the remote server.
nlist pager output to local-file: mls Can't execute `%s' Can't fork a subshell; try again later username USER %s Password: PASS %s Account: ACCT %s Login failed.
Unable to determine remote directory
Remote directory: %s
Local directory: %s
directory-name MKD command not recognized, trying XMKD.
XMKD %s RMD command not recognized, trying XRMD.
XRMD %s command line to send arguments to SITE command SITE SITE CHMOD %s %s SITE UMASK SITE UMASK %s SITE IDLE SITE IDLE %s HELP HELP %s QUIT Account: ?Ambiguous command.
?Invalid command.
?Invalid proxy command.
Not connected.
Case mapping Carriage Return stripping Ntrans off.
Nmap off.
mapout Passive mode: %s; fallback to active mode: %s.
EPSV/EPRT on IPv4 EPSV/EPRT on IPv6 Store unique Receive unique Get transfer rate throttle: %s; maximum: %d; increment %d.
Put transfer rate throttle: %s; maximum: %d; increment %d.
CDUP CDUP command not recognized, trying XCUP.
XCUP restart: Invalid offset `%s'
No restart point defined.
Restarting at %lld for next get, put or append
SYST Limit of 16 macros have already been defined.
macro name Enter macro line by line, terminating it with a null line.
macdef: end of file encountered.
Macro not defined - 4K buffer exceeded.
%s %lld
%s %s STAT STAT %s Local file "%s" is newer than remote file "%s".
sndbuf rcvbuf xferbuf %s: size must be positive.
Socket buffer sizes: send %d, receive %d.
No such option `%s'.
Setting `%s' to `%s'.
%-*s %s
Unsetting `%s'.
FEAT is not supported by the remote server.
FEAT MLST is not supported by the remote server.
MLST MLST %s OPTS is not supported by the remote server.
OPTS %s OPTS %s %s ebcdic anonpass ftp_proxy http_proxy https_proxy no_proxy rprompt account bye cdup disconnect edit epsv epsv4 epsv6 features fget idle lcd lpage lpwd macdef mdelete mget mlst modtime mput msend newer nmap ntrans passive pdir pmlsd quote recv remopts rename reset restart rhelp rmdir rstatus runique sendport site struct sunique throttle usage '%s' macro not found.
%s: HTTP fetch aborted.
%s: HTTP fetch timeout.
Host: %s Host: [%s] parse_url: invoked with NULL argument! http:// ftp:// file:// Invalid %s `%s' Unknown port `%s' in %s `%s' Receiving HTTP reply: %s Invalid URL `%s' ;type=a ;type=i ;type=d Directory listing via a URL is not supported Invalid suffix `%s' in URL `%s' *?[]{} Can't connect or login to host `%s:%s' fetch_ftp: unknown transfer type %d
ftp: The `CWD ' command (without a directory), which is required by
RFC 3986 to support the empty directory in the URL pathname (`//'),
conflicts with the server's conformance to RFC 959.
Try the same URL without the `//' in the URL pathname.
Pragma: no-cache
Cache-Control: no-cache
( localhost No support for non local file URL `%s' Invalid URL (no file after host) `%s' No file after directory (you must specify an output file) `%s' copied Can't open `%s' Can't seek to restart `%s' Copying %s (restarting at %lld) retrieved , Can't restart via proxy URL `%s' Scoped address notation `%s' disallowed via web proxy proxy URL Malformed proxy URL `%s' Can't LOOKUP `%s:%s': %s Trying %s:%s ...
Can't create socket for connection to `%s:%s' Can't connect to `%s:%s' Requesting %s
%svia %s:%u GET %s HTTP/1.0
GET %s HTTP/1.1
Accept: */*
Connection: close
Range: bytes=%lld-
restarting at %lld FTPUSERAGENT User-Agent: %s
User-Agent: %s/%s
%swith authorization %swith proxy authorization Proxy-Authorization: %s
Writing HTTP request already done
Size of `%s' differs from save file `%s' Unexpected EOF reading chunk-size Invalid chunk-size Chunk-size `%.*s' Unexpected data following chunk-size Writing `%s' Unexpected EOF reading chunk CRLF Unexpected data following chunk Reading file Can't change modification time to %s Improper response from `%s:%s' Unsupported URL scheme `%.*s' Content-Length: Content-Range: Received unexpected Content-Range header Last-Modified: Location: Transfer-Encoding: Bogus transfer encoding `binary' (fetching anyway) chunked Unsupported transfer encoding `%s' Proxy-Authenticate: Basic WWW-Authenticate: Not expecting partial content header No redirection Location provided by server Too many redirections requested Redirected via %s
Redirected to %s
Error retrieving file `%s' Unknown error retrieving file
remote abort aborted; closing connection.
receive
send abortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort.
421 Service not available, %s.
No control connection for command Can't lookup `%s:%s': %s Can't determine my address of connection to `%s:%s' Can't fdopen socket Connected to %s.
Can't create socket for data connection EPSV wrong server: return code must be 229
Passive mode refused.
Passive mode AF mismatch. Shouldn't happen!
wrong server: return code must be 227
%u,%u,%u,%u,%u,%u Passive mode address scan failure. Shouldn't happen!
parse error!
Can't set SO_REUSEADDR on data connection Can't bind for data connection Can't determine my address of data connection Can't listen to data connection EPRT |%u|%s|%s| PORT %d,%d,%d,%d,%d,%d %c%c%c%d%c PASV Poll timeout waiting before accept Can't poll waiting before accept Can't accept data connection Can't access `%s' runique: can't find unique file name.
Lost control connection for abort Can't send abort message %cABOR
proxy server does not support third party transfers.
No primary connection.
PORT %s REST %lld local: %s remote: %s
Error aborting proxy command local: %s %s: not a plain file.
Reading `%s' Writing to network Can't chmod `%s' Reading from network WARNING! %d bare linefeeds received in ASCII mode.
File may not have transferred correctly.
Can't change modification time on %s to %s Usage error
Error resetting connection remote server timed out. Connection closed user interrupt. Connection closed remote server has closed connection usage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime]
[-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize]
[[user@]host [port]] [host:path[/]] [file:///file]
[ftp://[user[:pass]@]host[:port]/path[/]]
[http://[user[:pass]@]host[:port]/path] [...]
%s -u URL file [...]
Proxy c %sommands may be abbreviated. Commands are:
?Ambiguous %s command `%s'
?Invalid %s command `%s'
ftp> prompt: no such option `prompt' rprompt: no such option `rprompt' Sorry, input line is too long.
anonymous http FTPSERVERPORT ftpgate NETRC $NETRC `%s': %s FTPMODE Unknown $FTPMODE `%s'; using defaults pftp FTPSERVER Neither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp dumb INET6 support is not available; ignoring -6 Bad quit value: %s Bad retry value: %s Bad throttle value `%s' Bad xferbuf value: %s 46AadefginN:o:pP:q:r:Rs:tT:u:vVx: Can't lookup `%s': %s /.netrc %s/.netrc: %s FTPANONPASS PAGER FTPPROMPT FTPRPROMPT Retrying in %d seconds...
getoptionvalue: invoked with NULL name getoptionvalue: invoked with unknown option `%s' %lld byte%s %s in %d day%s %2d: %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) xsignal_restart: called with signal %d
%s: transfer aborted because stalled for %lu sec.
%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA KiB MiB GiB TiB PiB EiB Token in .netrc too long Can't read `%s' Error: .netrc file is readable by others Remove password or make file unreadable by others Remove account or make file unreadable by others Missing macdef name argument.
Macro definition missing null line terminator.
Unknown .netrc keyword `%s' 4K macro buffer exceeded.
machine MDTM REST STREAM TVFS
Remote system type is %.*s.
unix 215 TOPS20 Remember to set tenex mode when transferring binary files from this machine.
ftpXXXXXXXXXX Unable to create temporary file `%s' Can't find list of remote files SIZE is not supported by remote server.
SIZE %s MDTM is not supported by remote server.
MDTM %s 191 Y2K warning! Incorrect time-val `%s' received from server.
Converted to `%s'
Can't parse time `%s'.
%Y%m%d%H%M%S %a, %d %b %Y %H:%M:%S %z
Can't convert RFC 2822 time: buffer too small %a, %d %b %Y %H:%M:%S GMT %a, %d-%b-%y %H:%M:%S GMT %a, %b %d %H:%M:%S %Y Unable to determine real path of `%s' crankrate invoked with unknown signal: %d Unable to determine rcvbuf size Unable to determine sndbuf size Unable to set sndbuf size %d Unable to set rcvbuf size %d
EOF received Error encountered Input line is too long Sorry, arguments too long.
(%s) operation %s; %s aborted.
Can't bind to `%s' Can't %s socket flags for connect to `%s:%s' Can't set socket non-blocking for connect to `%s:%s' Unable to allocate %ld bytes of memory Unable to allocate memory for stringlist Unable to add `%s' to stringlist ftp_strdup: called with NULL argument Unable to allocate memory for string copy Name (%s:%s): Name (%s): Login failed $init Already connected to %s, use close first.
main: gateserver not defined Connecting via pass-through server %s
non-print stream NetBSD gzip 20150113 malloc failed failed to read stdin %s: unexpected end of file %s: trailing garbage ignored input not gziped (MAGIC0) input not gziped (MAGIC1) unknown compression method 1.2.10 failed to inflateInit Z_NEED_DICT error data stream error internal stream error memory allocation error unknown error from inflate(): %d error writing to output truncated input invalid compressed data--crc error invalid compressed data--length error decompression error deflateInit2 failed deflate failed deflateEnd failed %c%c%c%c%c%c%c%c snprintf compressed uncompressed ratio uncompressed_name read of uncompressed size %12llu %12llu %2.2d. %5s%% can't read stdin (stdin): unexpected end of file (stdin) usage: %s [-123456789cdhlV] [ [ ...]]
123456789cdhlV can't stat: %s %s is a directory %s: unknown suffix -- ignored can't read %s couldn't close input couldn't close output %s: uncompress failed couldn't open (leaving original): %s couldn't stat (leaving original): %s stat gave different size: %lld != %lld (leaving original) could not create output: %s %s is not a regular file .gz D " D # D % D ' S-
SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS
Commands marked with * may be preceded by a number, _N.
Notes in parentheses indicate the behavior if _N is given.
A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K.
h H Display this help.
q :q Q :Q ZZ Exit.
---------------------------------------------------------------------------
MMOOVVIINNGG
e ^E j ^N CR * Forward one line (or _N lines).
y ^Y k ^K ^P * Backward one line (or _N lines).
f ^F ^V SPACE * Forward one window (or _N lines).
b ^B ESC-v * Backward one window (or _N lines).
z * Forward one window (and set window to _N).
w * Backward one window (and set window to _N).
ESC-SPACE * Forward one window, but don't stop at end-of-file.
d ^D * Forward one half-window (and set half-window to _N).
u ^U * Backward one half-window (and set half-window to _N).
ESC-) RightArrow * Left one half screen width (or _N positions).
ESC-( LeftArrow * Right one half screen width (or _N positions).
F Forward forever; like "tail -f".
r ^R ^L Repaint screen.
R Repaint screen, discarding buffered input.
---------------------------------------------------
Default "window" is the screen height.
Default "half-window" is half of the screen height.
---------------------------------------------------------------------------
SSEEAARRCCHHIINNGG
/_p_a_t_t_e_r_n * Search forward for (_N-th) matching line.
?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line.
n * Repeat previous search (for _N-th occurrence).
N * Repeat previous search in reverse direction.
ESC-n * Repeat previous search, spanning files.
ESC-N * Repeat previous search, reverse dir. & spanning files.
ESC-u Undo (toggle) search highlighting.
&_p_a_t_t_e_r_n * Display only matching lines
---------------------------------------------------
A search pattern may be preceded by one or more of:
^N or ! Search for NON-matching lines.
^E or * Search multiple files (pass thru END OF FILE).
^F or @ Start search at FIRST file (for /) or last file (for ?).
^K Highlight matches, but don't move (KEEP position).
^R Don't use REGULAR EXPRESSIONS.
---------------------------------------------------------------------------
JJUUMMPPIINNGG
g < ESC-< * Go to first line in file (or line _N).
G > ESC-> * Go to last line in file (or line _N).
p % * Go to beginning of file (or _N percent into file).
t * Go to the (_N-th) next tag.
T * Go to the (_N-th) previous tag.
{ ( [ * Find close bracket } ) ].
} ) ] * Find open bracket { ( [.
ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>.
ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>
---------------------------------------------------
Each "find close bracket" command goes forward to the close bracket
matching the (_N-th) open bracket in the top line.
Each "find open bracket" command goes backward to the open bracket
matching the (_N-th) close bracket in the bottom line.
m_<_l_e_t_t_e_r_> Mark the current position with