ELFT404 (44ۊۊییh/usr/lib/ld.so.1WV  "#$%'(*+-./14789:;<=?@BDHIJKLMPRSUVYZ[\]^_`bdefgijklmnopsuwxy{}    "$%'*+-/1234579:;<>?@ABDEGHIJKOPRSTXY[\^acdefgjklnprtvwxyz|}~  !"#$'*+,-.03459:;=>@ADFGIJKLMNPQSU !&),02356>ACEFGNOQTWXachqrtvz|~  !#&(),.068=CFLMNQUVWZ]_`bhimoqsu{    %&()/12678<?BCEHORT0 TD $, -h5L?p<4 H`` Q X8D _iݬp z<  p 0 `"  _L  L ` DUT\ ), | 59gP BKz< SP ^(edsܤ{ 8 \IX [$ X 4p |( t\ $ \   !T)_3یIp SR0 [^Dbut k sT |8q\$ t<0h xt H 4, p 70 4  $ /$ #((4 0hl 7gP A`$NZ es |m   Pwx` J, `L T ߌ |$m(  ޜ!ܘ(0 / 6A H Th a oP {|h (pp, ݔM@ <@ $H P  T}, $ ",lx 5X < D8x K<S$ ]do{ y  e , lT0 8 l mL w` 0 ִ  x d( $P /@ :s4 AIUa( !\d i$x Xe(l    xՠ   f   & , (6z@ >(h Ge(NWL `lsm {D x\ l8F (l p t d` \}( (P 3t *80<m(L D, MD X  ckJ w}<4 {8 0 }h( ݠk X rh4 $4    e$ L ' .P 48 <d D5x Mݸ T [a(  co l r| \      ih   < L )  ܰ y       ߤ #ې = Dr Nc@ Tu@` \o D a! i v }z   p  ,  ܀  ߰ e|@ l ]p $X $ t< $P a K  ި &f@l / 9h GXx` Sl, [  g  q( |L D^   B4L   $ ބ ]  h   nd լ ,    o ( 0yt  7@ =xp F Nx0  X d[ lp rB8 ~sH L ސ D *lt  L {\4 8 0  m0| H ` P   T` "P * 30 ?c@! D M x W ` gAL tc4 ~ p l4 +h8  | 0 d Xx` jTp T  , |( QT \d X޴%4܌;@CN| U^els ~, !4\ qh 48 `e@  d   ߀O$ ,P "| * 4xC$8 K2d V^g qU wv q {@ 0 tXt < |( ` bD ht  Rt }@(  oP< Z"L ,Bh 90 D9 Nw\ V0 ] f݈n(xyd ~}( , MX ܼi 4 n@ @|`@ x 0   ZL  Pۊ d  ' /P 74>oL Hz4, MiH Rؠ \tt clj$ uH~1 V8 kT +4 x4 s8 `l l[T  d D d % .$8oL BnD@ JPDWՔ  ] {4 T  ߘ,4 D $e(x 0L`zp8 {$8  L hh# .d 6m,;} AJe,T|\| co] y sl  h D p< ߼,ZlX o 8X G "'x0L <|  D5t4 Qp@T W`  l|@ u |8(  | ` , |  mtD &L %< ,jL 4nD 8X? FtLS` ^fmnD todayt_nometamodefinduidstrcpy2findfilel_cleart_reverseXopendirdosmkdirfgets2backuptcsetattrmemsetselectstrfindgidsorttypeprintlaunchcommdosintrfuncmarkend_standout_get_exit_frame_monitorstrcatdelimascnumericfunclistdoslseeksymlinkstrpbrkloadhistoryt_normalexecmacroprintkeymapdupdosfreadc_return_Xrmdirsafecpfileexecleend_underlinesprintfstrnpathcmp2copypolicycmdlinelenfreedosstatfstitlefindduplendtermXfread__fsr_init_valuestrcpyrenameregcmpsizeinfofinddirmoveposremovepolicygetinfofst_blinkmacrolist_GLOBAL_OFFSET_TABLE_ujis2sjisdosopenwinvarXsymlinkcmptreerealloc2calc_xXrewinddirclosedirc_insertcalc_ysetpwentforcecleandirgetgrgidevalpathssetscrollt_resetcursorisdelimXreaddirdosgetcwdfseekt_nokeypadstrtkchrpackforkputenv2getextdosfcloseuserfunclistcfgetospeeddefcolumnsfd_restrictedmktmpdirwritefsdosallcloseatexitgetargsc_scrollforw__majorunlinkXutimesdosstatrealpath2isdotdirfreadgettokenfdopenputvarfuncregexevalenvsyncgetlastpidfuncfclosegetwd2putch2fnamekcodeputch3displaymodestrcatdelim2transfilelistrewritetreetmpdosrestoret_highcursor_DYNAMICcc_intrXclosedirdistributortgetflagdosunlinkn_lineenviron2tmpdosduplatoi2gethomedirpreparedrvgetpwnamrename2inputattrhideclockdosfgetschdir2archbarchdir3t_vbellencodestrgetcwdlaunchlistc_scrollrevsearchdirXwritePCsetgrentrmvdirdosfgetccprintf2t_metamodestrrdelimraw2mktimeXchmodevalpathinruncomstripquotemarksizemain_fdn_lastcolumnqsortdecodestrevalpromptgettermentXchdirc_rightarchivelist_ctypegetblocksizet_normalcursorcc_eofkillmetasubwindowt_scrolldupn_linecc_eolgetmntentdosfilenosorttreeshowsecondgetrangestrrchr2tcflushputenvlastdrvorigpath_finidosfdopeninputstrc_leftt_endhelpindex_Xmkdirapplydirospeedsavehistdoschmodoutputkcodec_downmesconvkeywaitfuncstrchr2movefilegetgrnamt_bellrockridgepathcompletebuiltinwritewaitmesinittermlistupfilec_nleftregexp_initt_underlineXfgetcsafewritettyioprintaliaschmodtmpfilenamecooked2ungetch2kanjiconv2kanjifputsc_ndownevalcommandchdirmalloc2__cg92_usedXfopenstrncpygetkeyseqXfgetsmemcmpgetlangkeyidentlisthelpdiscardunitablelastdrivefreemacropreparedirgetvarfuncmaxuserfuncUPdosreadlinkadjttyyesnolostcwdstatvfsdoschdirselectc_home__ctypekeyflushwin_xprintarchcommgetenv2getpidwin_ycolumnscompleteuserfuncsearchhashc_nupgetpwentdossymlinkprintsetdrvchownstrncmpXreadrewritefiledestpathread_chdir2getkey2fgetc_PROCEDURE_LINKAGE_TABLE_cputs2unifysjis__iobXaccesstabsenvironcompletepathmemcpyXlseekfindcommonl_deletetgotormvfilehelpbarfopenc_newlinefgetsevalhistoryintrkeyloadruncomdeletedrvfdtypestrrdelim2insertdrvsavehistorydoslstatstrrchrdosfopensetkeyseqcompletealiassys_errlistwarningpoparchdupltotalsizeneedbavailkbhit2_edatac_locatedeftmpdircheckinternalgettimeofdayincludepathgetuiddoswriteioctlsetenv2fullpath_dospath_lib_versionlocaltimegetgrentblocksizesjis2ujissystem2Xcloseunamestrdelim__minortparamstrstrpathcmp2dosreadpopenexecbuiltinXgetwdsafemvfilelseekutimeslauncherusegetcursorskipspaceXrmdirtputsstrcasecmp2getarglistfuncdosfputst_boldtflushstrlenstable_standoutkillgetenvvalfreevarprogpathevalnumeric_iobvsprintfgetstatusevalwildhistnocheckbuiltinfilestackpathignorecasetgetentdosfputcdosopendirsignalpclosecalcwidthchgcolor_sys_errlistopentty_startdoswaitfuncXfwriteinputshellstrapplyfilet_standoutopendircheckundeffuncstrcatt_clearinputkcodeextcmpc_nrightn_argsaccessperroradjustpathevalifscloseprintmacroreadunitablekanjiprintfgetpwuiderrnotransfilewritablefslogical_accessminfilenamermtmpdirrmdirprognamedosrenamestrlen2n_columnstrlen3removetmp__environ_locksetattrdosreaddircc_quithistsizekanjiputserrorXreadlink_Xchdir_XfopenunderhomeXstatisexistinternal_statusXfflushstataddlistdosrmdirkanjiconvflushdrvinputshellloopttyoutXfputccopyfilenotabsarchivedirdosaccessexecinternalsearchpathsearcharcXunlinkgetch2fnameofstgetnumansicolorXopentypesymlistXfputsgetkeysymdosutimesopendosfwritegetretvalfuncecho2reallocXfeofevalargevalglobarrangedirsigvecresetreaddir_exitt_dim_etextmainmaxmacroXgetkeystrdup2mallocttyiomodeXduptree_evalpathXlstatexitfunconkanji1endpwentunpackdosclosedosfflushdosclosedirXrename_Xgetwdkctypetablegeteuidunitblpathputmode___Argvl_insertbindlistgetegidexecusercommevalcomstrexecpseudoshelltypelistlowercasestdiomodenoecho2fputcstrchr_init__1cG__CrunMdo_exit_code6F_v_tmpunpackstrncpy2strncpy3fwritelocateputnameuppercaseBCarchchdirfputst_setcursortcgetattrtgetstr__xargvXdup2findregexpc_upXmkdirtouchfilegetenvdup2stackdepthstrstr2_endstat2t_keypadaliaslistc_storemkdir2getflagfuncentryhistcmppathcnvunicodelcmdlinemaxlaunchhistoryisearchregexp_execshutdrv_Xopendirsystemlstatt_nocursorcurfilenamesigvecsetdospathprintfunctioncompleteinternalexitc_deleteregexp_freeXfdopendosrewinddirexit2endgrentdetransfilegetwsizetimelocal2Xfclosebackquotefuncdosdrivemaxaliaschgorder__xargceditmodereadlinkmaxarchivepromptstrdircountlimitcmplist_environkanjiputs2cbreak2copyarcfc_restoreinfofsinitttynl2strcmpcatvarmkdirfflushgetkeycodeseekdirt_initnonl2libcurses.so.1SUNW_1.1SUNWprivate_1.1libc.so.1SUNW_1.1SUNWprivate_1.1libcurses.so.1libgen.so.1libc.so.1s0 =' Nq =' Nqe(e ee$eca(Xx9`0zj C,L8bDPh\+ht2܀)܌ܘqܤ'ܼܰ  "Z  (4@L XNdpw|k݈ݔݠݬ ݸG&Qp 4$m0H<HT`lxJބEސ\ޜoި5޴ES) ,A8D]Pd\3htP߀ߌiߘߤ߰+߼(M6U(%4Q@RLXdpX|{cT @"` D"`x"a, @'x᐀ $+`-` `?-)x!- =--% # @!5@!!x! x!@!@@@!@!㿠;9xa@=;zc!@U@E 1x!73@ @, @!q &a@!q @!e㿠;z@!l c;xa@U@E@ p@ @!] @!^@!^㿠;Ub@!S  㿠;Ub@!L  㿠;Ub@!E  㿠;Ub@!>  㿠ʐ  㿠Ő  㿠  㿠  㿠  㿠  㿠  㿠  㿠  㿠  㿠  㿠  㿠  㿠; a;}@   P@ @+ b 7V@X 5@  & 㿐; a9x@ ے !`!+``%`` x9@ ֒ x' `&a܀`1 Q1@ ɐ ` xxx3 x 2 2a!?#xaܘ !x !'x)5##@ @- xc"X@   z ] @:  `=   /  (`.`%@!܀+x #5@a)cb`'} %}@  @ @ -& &7V|@ i % 㿠;V9,`|;V@ _  7y@ [ `"@ W 3&,1yc�㿠;U9yb;U@ I   @ E b7y@ A '#,&0㿠 ;x@ Ē bX;c9`7x@ @ @ d"X@ > J   N` "@ 2 '@ 0'5!Ԓ@Cxᨀ3x@ 6 # #@a)5a!%x& #c% %%@'@-|``!x@   $!㿠@c+J ` ` @y `9x/c"h-@ +@@b)5!@5x3c`h'5@ܒ @ @ a@ސ `2?+ ;5@Аb&7@Đ@@Jx@J@J@@k @Hx/<+ @ 5@J@U 5b@`5@  ?@ @ @M    v `L`;hL` #d@q@"  L` "$L $ L "$L "$,  L`\$ $L \ $%`@ ,  L`@4@1@@I@9@& "  @ @@M12`  & @@ 2?㿠 @I/`` " " a 7 ) `K +6K`-OM` JM-N`@H``N`_"`N` 2``@N`0 N`9`N` @ N` ="`@$  $  &$`& $`@@&@@㿠  2   =  K`-* L` " L- M` "` @II@^*`` @Kߐ@Z `ں``㽘;x@  'aa&&@);5@Kb@I9x'!ԁ㻠@LA;x'aa;@1aԐ@ o " ` 95 "$`@,`` , `  @@ 5x@H1x&!́@F @@ U 2* @Hː7x&́㿠`9U7U;Uc;U@Ð b/U@ "-U@ (+U@ <)U@ P'U@ cd%U@ #x#U@ !U@ @ c@ #@ U@ Uc@ V @ >~ "` 8~~~ ``("*`!* `)`+`& -# -@@Hg`*`# *" )  `,"( @, @@HW`+'.%+`%``$`` ;~ '`` ,~  !`(`!`, @@H2`/ &`-@H*`+`#`*@H"`*`!` $`` a@H $ y( 9y!(`@H%``` `    +@Gx#a  ;xa @G $`x -7x- " )%x` x{!̐ @@ P@ f xb' @ M&"$R`  x"#@@ ;@c@5x؀ +@@M @c )x@} !Ȑ 'x@}  @%x#c/`@`@@63xa@E7x-x@@@/x@@n@  㿠;xbȀ`55, @!3x&b 9x@ 7x&9x@z 9x"ȁx;xb؀  2   Bxdbb@n܀  & @h?' @Q 9x@` $`/x+x'x#/"`-`-b`,@U4a( & 3 `@M & @;?' @%  x.`5^@+..`5/ /`6`5`5 `@ `@''܈'ܒ '' '#g//ܒ`@ @ 'x$ԁ 㿘#\ 9x#`7 5/3? #d"Ȓcޖ$  㿘 #`7?;x9 #\bȒ #d$  㿘#d;?7x53>c #\#`c    㿘 #`9?#d;x#bȒ* #\ w  㿘 #`9?#d;x#bȒ  #\ g  㿘;?7x#`cǸ #\#d  Ȗ! V  㿘7?9x#`#\ #d "Ȕ  E  㿘;97x#`c #\#d  Ȗ  4  㿘 #`#d;x bȔ  #\%  㿠;xb@^  㿠;xb;x9cb@ @ 㿠L;xb ;x9cb@ @ 㿠;xb؀`9x7c"D@ @ @Ґ 㿠;a;xb؀ %x؀`)x'c"D@ڒ @y /5+8-@ %a 35@b< 75@@ @  x P#a$ +a >">"!$xx a x#b?x"?x"b ?x b? x ?x#"?x"?$x"" ?,x $?4x#b(?<x",?Dx"b0?Hx b4?Lx#b8?Px#"<?Tx"@?`x""D?dx H?lx#"L?tx"P?|x"bT?x bX?x#b\?x"`?x"d?x""h?x l?x#"p?x"t?x"bx?x b|?x#b?x"℄?x"b?x""?x ␖?x#"?x"?x""?x b?x#b?x"⨐?x"b?x b?x ⴄ #"  j ሄ#Ĕ ؒ А А     ( 0 8( @0 H8 P@ XH `P hX p` xd h l p t x | Ȑ Ђ ؚ P X ` h p x Ȑ    ( X P x!#ā 㿠;xb0` #xb4 )x"0'x%c@#-x@#@ @0` 3xb49x"47x5c@p㿈;7xaȒ @  @.NN `` ( `,N''쀣C O?  O`%+`Od& $ ML`L L` .L`L`+`` "0`   $`MO `O`M㿘  @;  2' ''N    %@  @&N%" N.Ÿ N% . `ND3 +O.D2-3>"Y Bn Dd i"ehr"Z5`"H`@@`  5`@"L``w 5`@bT``m 5`@\``d  N N5```@ @b`S @k N` O   N`A N`$`< @T ''3 `'', `' `'$ ` "g`X@@Z@@=8`&@+`: :`+ !- @$`  ``=` @+`%@ *"@ $`  N`& @ @ .㷘'@@ `@@/ &   @ 㷘'@#@ Ԕ `&  ` `@̐@ & Ր  @ʒ 㿘'&! .` `   @' K`  M@L   MN@ 2@&j߶' 㿠.`` .``&@.  .`%@,  q` `$`$` ?.&-%`%`%`` 㿠.`?'.@  ``@/  `?``  `@W㿠;9_`# k7x@Q ЀÒ  5 1$    * @  `  I*@J  ` - %@+  ^ % @ݮ `jР  㷘;xb؀`?-5@d"@1x`"5x/5@l&x ` '`$J *a @ !`($`,'`0`4 |`8w`<@z9x`@'" 'x$ #`%# "$+x)x@`D%a7x%!@`H&@`L5x%&;x@`Px1x b5xH`T" /xD`X-x@`\+x<``)x8`db7x4`h" 9x0`l$'x,`p"(%x(`t,#x$`xx!x0;x`|x1xb45x`x/x"8-x`x+x<)x `@7x`bD9x`x'xH%x`x#xbL`"P!x` x"T`xX`x\`x``bd `"hޒ`lے`pؒ`t``Đbx``̐"|͒`Аʒ`Ԑ"ǒ`ؐĒ`x`xb`x"`x``͔`b`ɔ`xaĔaxbaa "a x"axaxa "` @@Ɛ '  `@& `j a !a$!a(!!a,!a0!a4!a8! a<! a@! aD! aH! aL!aP!aT!aX!a\!a`!ad!ah!al!ap!at!ax}!a|z!aw!at!aq!an!ak!ah! ae!!ab!"a_!#a\!$aY!%aV!&aS!&aP!HaM!IaJ!JaG!KaD!MaA!Oa>!Sa;!Ra8!Wa5!ba2!h   2`,` j4 ` ` 25/ĸ  `` 5 (! 0  aH`% 2,    )   K`  N@  -  M@ )     j`7xش &؁ 㿠; `-jj@@` @' j/@`?#   @"" ` @2@]$,``j=  ` @ *j `" "`  `  "`  `  # 㿠;xb؀`9xY"7x3x1x5c@b/c"@ @+xbب%b؁ 㿠;xb؀`9x?" 7x3x1x5c@b /c"@@v+xbب %b؁ xb@͞xb̐ @Ǟxb@'x ' @, xx `'x@&㿘;xbb@  /  @`` :?㿠;xb1x")"   `"  2" ``'`'`@s@t  " `H7_@  !)   :b`` - `@-  K ``@ `@ ,``1  ((`@B@`5/  !` 7 `@ ,@ M `  `, ` 1( (`` @`* !_"@)`E`@ +)` 5_ `` `.`L@`  `6&- `"*@)  @"``Ԩ  `#`/ @ !㿠;x9/GbȒ @GG㿠;xb ;x9cb @@ 㿠;xb;x9c@b@z  㿠;xb@ 㿐;x?b;?`h@Δ  `4xĀ` Cx?? 9  $7$@7 [+`3  77 $7@$ _.5@7777 x"Ȓg7@{x` ax a x$`#" 7x 4$ + +c5 5 `' N? 㾠'H'L'P'T'X@FH㿠 95"p ;5bx % ( ;5 (bْ  㿠 @6I N   N`/"N`  㿠 @6) ` O` O`/"O`` "`@*  K` /#`@  J `/  㿠@5 2 N N`/MN` N /2 N` /..㿠@5 N` . N`. N@2N@ / @J`  /.%N@  @`N@.N@/2` ` `N@` c. /.N & `  N.N`@.J xJ` $ @ 2 x$K```K  K` `   xc`J`J  J ) J``J J J`"J xJ`#$ ` @ 2! x#$J  J``J  @  !  xc`*"J`J  J ! `  J J` @"x#$J J` `  @ 2 " J  `  㿠7x@4쀦;xb@:`@;|@=g@$㿠@@:Ӑ`@@ =/@@;c-x` )x" @n @㿠N `5 ` @ ^@: * ``    \ . * 6-`@: N`]" N. BN\   N. N.3N? $!*.! [" ^. .  . N.  .  N. N.   $.  .㿠N `*N ? ;x;x 'bx@ܒ @j㿠 7xN` ."  @Œ   @A㿠` @9@:1N `/ N /    K `/ N "&   /`@9ߐ @9Ȑ@u&-@:V@&'D'T#`N\$TT `@9T /*T'T*``@9. `! ` ,    @ՐT`@3a @9 N` :* ` * * `#\ N` N@/N@*" N@ ?"  N@`[" N@]2 N@`T /@9\T`*T 'T*#\T``FT> @4wx@s1 N@` < `@e# -`@@9(x/` " "#\T`U`,    @9.`` "`'@@>2N``.N`**N``*%  @8ߑ/``      @8T``#\ T  @ @ T`5@22#d @  @ #ht@2#l9`@,`#p5<#t @=!T't@ ŐlhN@ kx@3a @]@8jp`   " " x*  `.M .`@ @ T x @@`@@6#\@ {@ y;`tt2  2#\@ f@ d&t`t_@ W  `, @8(``%`% @ >@2Ldk @2<d @ 0 @ + `{㿘@7ِ '  #\   /`@  `&9i#@ H x@2?;<7`?`` ?@3 㿠 "   Ԕ &e  "5?V  :@  D @1M2L @ %@   @ @  @` @7]` @7@ -"@@7ה`&   @ p 㿘 " 㿠 @ "/   㿠@ A@ @ 0 ~. ``@ K!`@ -@6 *  `ɒ@  @6& &@`@ @ 㻐c\#\#`@7L@0  #d@0`E /#l, %` \@ l2@ Ր,@7#d`!@6`@ , ,@`,@_@   @6x& #`@0Ƥ G, #h%  @:8\@ h2@ ,@6ܔd`!@68`@  ,`,@ n  @61&`#@ @0q¢ @0a㿠;c? / :@/`@ >@ 8%@@ 2@@ A@ +#\ @ "֐㿠@/   w @ '@`@ #\N ~ &` 2#\#\;cԒޚ 㿠,  (  @5    N` O N@ O ` . N`@    H` {"Ț  \WH " "I`*`F`H \ *<`I \29`` 5` H ' "+`*`(`H I    H *```H  "`I    H *``` H `H " "E`*B`H \ *9`I \5 2` H ' ")`*&`H I    H *``H  I    H *``H ` *H `㿠    @ ۶   #c@4 `2' @4`@5`".`>/@ ``@4@`"  @4@ `"8\㿐-m& ! -#xb'xĀ` @   ````  @46ܺ@% *'@  @4 "|/@.` = /@  /@ /@ @ /@f@%x``3xbZ 3 V@1x" P-x@K@  5@ b9@x􀠠 x"5@ b(@@5@@xb !x"#5@b @'x@;xc@@@3㿠`+  ` ``= N _ N !) ?@3L @3`=`?  @̔ &`@```=?`VG`@p?&``?>   N @C #5b@ %5@`M`   `N@*`M`5x@?&`@ @`" ?9x?#㿠@@@&`@2㿈 #\ #`#d#hM`_L`) @L` { L`  $`\/@\    &`/{`a)ȸ???`  L@`"ή?L@  L@`M  M `   L@ `'M ` `'M `   " L@\`M ` `M `M ` ``&?`2s p 2n L@'d`L@"``L@=-  "r?+",`8`':"`2`{ =?"`(`}" & "``&T?   : 8 66   1 ` (` 4&  L@"  5L@@;b ? $ L@ _" L@@  ?&?L@   D  `$ ` @&`L`` )`!)H _"H `H``&瀤'`?' L` _\ L`!) `UL`) `3`1x?"xb" $L`"0`   5) '2 $`\,`L`\``-\ 2?L`#'" $#d`\ /@ `L`\`,\ V'/x 9x#?`H"' d`V@ed d "@\d#d" @2h`"@\ `$`\`\@.h`#@\ `%`\@\d@d?㿠!xc c @= .` %-`@k 5x`   / `  ` &* @Q %x ;  `+ >``@> --%@@0|,& .'@.`% @0- %@,@$  @0+'+` ")  &"(@㿠!x#  #  @ @ ``@/`@ %x      `- @@Ր x  8` `@(@  ; `;` @/*& /`& @0 / %`&,㿠;cߒ?@  2 㿠`L "@` !5"@#xa`@/@06  Ԓ@ܐ2`  ~-` @ː &  @@)@&㿘@ @/m' @/g' N ` 9{ "Ȫ ?H`  H, `J`)K K @  M`, H- '€ J @ N `  M, H(@' `'J $J` +@<@:6 .  K \K` ` KM H(@ 'g 2x `.K `*  da,!x# @"Y? ?N@`@. '?@A`0M'N "J~$ "``:`= # H`H, `J`) K`, M+O  'O 2"@/@㿠 . ;{bȠ`   `H ̪ `@K@ `I `K  ``M` ``'`O  `  `'"`@H\``H``"`@J 2}`K `t2r`@K`'h`J"b`J@@]`K`@H@ ` H@`I ``@@K ( `J``?- -`@*`@J +`@-`@-&` ` `@#` ``  !  `@J`J`82 `@ ```#@& $`$ % $  㿘 #\/{ #`Ȥ \ @-8``,`  @ I  `6- @-5`@K 2`H@ `J `  `J/@ª``@I`'`K`  '`H/@``J@ \'`@K  `H` `J` `5K@@"Ȁ/@}`{`H@'o`@I"i`k`5@K@Ѐb`[    ``-`@,) &``/ - `" ` @ "`""%@ `@`` @`@@@   `!  @@ `J2`J/@``K@  `  \/@,``@t`%@`@ J  `p { bȖ  \J @ `  2^ XJ ``K``@`J  `*G J `@`'K``@`'J  `*5 3J `\ K``" `K`@ 2`K```  J @ J `\* J `'J `"J  `2 J  * J ``*㿠&@@@+ @,5 % .`@֐@ѐ@+ N `y 9{ "Ȭ   \ Nf aN `M @N .@PN `'M ``'N .@><N \ `M ``"  M 2 M `  `#+5N@wbԀ.@N 'N`" N/ / NN.@NN .@@S㿠 NN " N    J ` " J ` "  A @-㿠;aa ,`6`@  $^@@ 5y&P&?& 㿠9!!?  $^@Y` %`  $^@L`;y'cP?%` 㿠9!!?  $^@%;y'cP?% 㿠* .`9")y@@@#P @   `` ,$?&? @$,`$`%㿠9y#@  + +y7, c@c@&.`% ,@ @ @ 2& @  ,  `&?,@&`&`;y7c@c@%@  @ ` `% @ .`a@` @?` h `@" ,? `0&h*  k&@ !  ߒ``@    ! -# &@ ` @@,a.`/ ߈@@@``    `)  %`$ ``( * "@` "@$  _ $$ " `(     ^  ?+Y 4A !  `   ^@  @$  ^  $ &'ޤa``  ` !( #. #@   #*" &@*@ !+ `@ b,2 " " ?(+`@     "*`"`   " " ?) !"@(` *  `!   ``*`` 㿠  b @@ P!  @ F.`@ @@ ?@ @ &   @*"$`&@? @  @&  @`-%@%?@@ 㿠-` / . "`#%` ]@ ` - `%%?`$@%;  % `  % ߒ?`% $@$  &V &?*`ࠐ#@ !y?#@ 1#&#+   `   - ` @%  "5- ` %% @s`  倦y"#P&? 㿠-` / . @%` ] `  ./ %& @b?   %& @S ? &Җ &?*`ࠐ# y?@$@% ~ . , ` @  `-` ` @ %`"5-`` %`%@`  倦y"P&? 㿠-/ . @v &?l $?*`ࠐ#3 y?@$@%  0 . ` @  - ` @%`"5- %%` @`  〦y"P&? 㿠  ;\@y#@  @#@9" @ @2(`@ @@M @ Ӂ@@ J@@3a (     \@@ ?- 4X? `    \@@ `&  \@ & $= 5+` } + #@+ " @ "*`! "(`  #+@ #* " *`@ غ'` &  ??㿠$ /;y#\,c@ ߆@  @ ֯-@ $    &@ % *@` @| @&\ $ư ? @ /  @@ )    #@\@`&@  %+`` @P '`\ 4?'@   3   -@ #'Z ? -,@` @ &` $` ? @F   @ b"ZK`?  -` @ @ &U ?`@  & ^ @@'2  %? =\㿠? ^㿠 ,  1y&#P?  }?` ^㿠;yc( L H ! @;a1y&#P'a?/y, #yc,@ ,  L  /y 0`   @  )  @% ``2 ` `2` `"`` ꀥԦ  y@? ,y  Ac0 ` ` @ѐ  E!  @ % ``"`  `򀥠   y@?  `  @  e` " `` ` "* )'6 , %6< @@ ``2`69 @ `"` $ , ۀ( +` 6, 6>@`     6 9 @2    y@"?y4 -+4Hb,  $  0`  0@   㿠; 5a _& 1@+& "1   h /-y%P @)%!?1&! 㿠5y 4  34b0 ? ( `  `  " ,``00 0 "   6  7& ?     " ,   , `2 Z@ 08@     Z@ @  y#cP? 㿠 ;a^@ %)y %#P$>` @+  Ԗ@S 㿠? `  E ,`   & >" "@> . [&  $ 6 ?  $ >%@% >.9 _& ,7   (*/`@@ 74 , ? c +` @3?%c@!6`@, @   =`- o  /`oo"@㿠?   F ,   "  ? !@ "?  . Z'  #`@ 6 ? ` "`@ ? %%@ ?  ./ ] ' ,       `  `  >,,>,>,D ,6`   `  ,>,1@(@      .>, ,  ,   `  >, ``, , , . ,&  ?    l    @Ԑ?@А )!y #4` ```2$` @ 9/"H,  `&``0@0 ,``  "@  `@ y ##P c@  y P "`  R @  `"@    @@  y "cP ` , `+` ` `*(` 㿠    `   @ ;y'cP?㿠? ,    5`̒`  ?㿠?b ;y'cP?`  |?7& ?9#/?㿠  9 !]@ ;y3a'cP?&a @ @㿠S&?7 &?@ @ =? 㿠 !!q m!d  ,. ,z ,a^@> . ,=%@*#@ + *&``?t  & $@m!    $      @Y! 7y&P$ ? , `. ,y#T  R R@\  @B 1y&#P$ ?'yT@ U@i   U@^ `    @@$  & $ ` `- @  `! ` `" `#(`(/`@ ` ` `, `@+ @ @Z7`@9 @=.+  @@ ` .  ` ` .  6   ` ` ` . 6 ` `*&  ` `(@.`= .'  6   &   `  `% `$ `& `'(/`-`& 6  `- `, `. `/-  ,,`+` &  . , `  S  6     @?`@?3  ,& & `$`65@[ #5b@T )5"@M  o  ,`. ,  , . , @$$  @$ ?@@9 > @$   `?& $9y!( 7!(  ? @'" / @2/ $ $@  @8 0& $@ Z&?4 ,`  `Ӣ`,`2   $`  $@;y'cP?pyc4 '`?`b,   ```@`0`6a ``\`%x$ @  `?' .`+`# +  @  $` ) ?/  @.@ 0 /&af6'?d&a@? 8`@/.`.` /#+`@r 0`@?`'`` '`- $ '`?㿠yкc4` .b,&@,`@Ģ@ ,1 ! A@ `` @ ," 0 @20  0` 0`#-%@ ,* (    (@  ( ,   ( , `,&?  (@ @ `C$`  ?79@  `c 4?   $@@ $@@` ?`%`- `"``#'``@ *`?? `$`@ ,``?`( (`?`"'``  `, $@+` %$ '`?㿠5y;x4c$ ` /y4%,%- %@,@" 0yc, y,€yP?#a㿠  ;ycP;?'ap-+y5x;c8$ aܺc8  F?` P x |#`+ *`" *  4+` + $`?(!.@"*# * @ "`( (`@+`# + "*`" *  (`&++@`Ů%  `9@'!`, "` )  P?9P80 @  V `? @@  T` x@ x` l @ t@`@@@6'`? & a'|Ѐ& a@?`8@/ P / P @ 0"a  +` J ;`  @   㿠`  & _/5@?.` _.`@/ 2 @V * 6㿠 `/`.2 @V * 6  + ``,`[ '  &`." $ ` +`'`& ,  [`$" .㿠 /5 @35c@75? @ޒ;x c$?㿠@̐S ;x9{c$"NN@  5 ` 1  (NN@/ N @- 2 @V8 ,N@* 3  *2 @V. * 2@  '@ N@N!N@   @2' 'N@  N@/ N@  J`   K ( K K``  .* K`   K`(`K`  * J ` * 㿐@@7@*'5$ @L@'``$`@ $ L.$  9{"Ȩ  _ @C@AN``=N` N`` @`N`N``+3` + @ ) 2 @Ur* 68. .  N`.` N`Ҳ`$ .   2.%  .  @@N` 2  #{bȸ _ 75L 1L`@`L  L.L. Le.L$ .  2.%. ƀL2 .(&5(@j@S `  ?L ` #  $  ~. O􀤠  @M``- M`  ` .    ! * 29 9 @ (0` ) 3 `I + 2 (00 *`2   + 2*  3`!  <     `  0   x. 7`> > .`P' 4%';` ';` '+` ?' >'@܁㿈' @'_@? '< #@@   &P ` -  `? )   * - >8`- `5+``3 `& . =`. ?`. . 㿠@ ;y'cP?/y$  3 a&  9y'#$㿠?N`#xc$ /`L`\! A,    /. @P @EL``;{bȺ / L` &L``/"L`\`L@`" `M  "```L@` L@/L@\>`L@ 9``L`. ``L``.`L`. ` , @@cT@M`."&` a  , @N@>y N"#P?`4@``L``.".`L`.L`. JL ."&` #a  , @@ 7y N&P?L2L`_  /,   $ ',2, x#`#aa #\ & Đ . /$T/`@  @$($ 7y*&P\$  @ ,@@판  ?)y %#P\$' ' ' ' ' @@ X'  @q'  `5y@ݐ &P\$ .`.` : .`#`5@0%۴@ "ؐ@' ' @*$( /,@@M ` `   /`.@`@@\#`.@,`M z /ذ@ #d+" @ِ@bO``.\@B`2#hh`   */`" #-* @$$N@쮐`a `+``@@쪒 #`@H y N!#P \$h @ 0d' ' ' @,@*  -yP` !y#P7y$@'&P \$M M` "\ 2 \%y @$P\$ $ 㿠 7 ```@I` @C;'a㿠  ;ycP; 'a㿠א ;y?cP;'a㿠  1y&#P?& .;1 b,   ( (`ې? %`T - %@,@ #  & + & #@ * 2$$  @    &  6&  㿠 ? ;y'cP?  /`,`.`". @?` `"T*" *`'$ '`'`T`-`%- @3$`` @Ք ` ``  '``6'` h#`  c t/ $@ ,? ?#\ . 6#d  t\ x#l+?`#pc` #t`#h `` `. l6? `  L`  d ` @$. l6L`@ gy y) "* p@ H .`#,@$$2L ` #d t,&@+` @L  @` 6h``LL@* 0` @`;`, , ` @@ " ", , @ @  J*""@  /`3` pT&\* t,` @+tdd\?+?y H\L`t  +`\- &@ "@,-`L `\@& &  t+ @/`  t-&-@Ꚓ@PU? t/y. & - @-%P@PF?㿠ޒ ;ycP a bX*# *@+O` `'9{5y"Ƞ$` O @ O  `   O C/  O  /  O `㿀9@1 "X("@(`@@D  -_;bT  *- " %@+* @$9I 2Bb; [5 /O (     9y'#P o4 (    #!? " "  㾘'ycP-%? x`#$&`a`   $N /%yN \/` && +y)cP%!?%y#P$a?O "/@g@鞐 /`?5@Y%;y@Z'c$ 㿠 y@}y  #'yx#$$ @  # ' A- @  - %@!  ";'a 9y /O#' :`/`/`/`@㾘 @O` " 9{ "L `   L  L/"L\2L    &  /,,M㾘'D?&`Dc ?.+%bT-O`O ?ޖ /; :/a'DD  a ycP  yP' Z y?"P' @$($ -I 7y&P?' XT `- - %@,@@萔$(DK` =@DD4D!#ycPcP 2 ' `  &` ?$ '  -T.&@-@U$(ؐ' Ӑ $ *d ' ?㿠. 5'@T/ غ` u y?"cP`d$   ```$6`@-?i  `$@  l  @ݐ&?㿠. 9'@"T/`-X`   `@ %y #P?%, `$$ ?`  d@ `6$ `#d #l8 ?/y :/P #\' #` 2 \`2V?\ ?#O` #\ ?& @ \ ?%`bX#h, $@- @   W??H`: 5{,ȶ J@@@?&N J  `  @H@L* 0I`* 0,:, K`2`@Lؒ? -+;``O\@? , `< ?& , `h(!* d  \ ?$ \ ` @ 5c0@  O`0O4O ;5c4@ڔ  O 0O 9O ܒM@" N    l? Dh? `  ``2```* ,"%+`+@$ d$%&&? `  @拔 O67   ?zl`H`\```z h` * *d 3``h-%@-?`, `?h,``'/`,Ґ\ " `?h+`%?*`) \  ``h`?`-%@-?.& m#p.  "*  *  ` `?``@9p-`  ` @-` -` -` @ @@@*-@  -@ *  @ `l \`` & $ `?h/``", - 7`@p@娔 d -` `?`(` .h`@-g `Z@ `;  `:  `#-` -`-`-`-`-`-``Ch`?ԡ,$,|@h`. @.@@ӱ` `@H?`@<@:ߐ\ &?㿀. . )%"6-`?6`d d$ ''' Z@ ''@B''? dݖ/$ސ. ' $ " @$$ ` d -@ 㿠yP"?.%,%,  @ @@ [@U@  l5y+P%a?@&` ,&`&`.` @N` `.` W 㿠 3y1cP&!?/ +&`%'-bT,@`@$&`` ?&`? &`&`&` ````   $*`(`-@&`0```   $`,`* dk@ &`8&`@&`H`9< @!@Ғ . @7 1 Ti7Xc9 \]``I&` x`? `x/.X&.  @   ` `@ ;'a?  #a? #a?㿠  'yP%?$./'@Tϐ. @-$ 9y#P3&a㿠` #ycP!?$!/ -'@T-7yP5&i㿠Ȓ ycP5?&.""T*``  ?#!`   ` ,$`+`Y-`,$ Ő1y#H/yL7;yꂐ;y9cP'!?㾘 5yP!$!? x #$ @ "?yP[ )%!?.$T-`@O`O`?  Ԑ# $a? . Ȑ5 &?!@!7ﻐ?"9 + ?غ /`*@@@.` @9-*`" * {zd`*# *@$ $ @   (-@@Į@%쀦 8.`(@-`8"`$쀡  +` . @+ `9D9H@ -&+@" `@* "@) 6d$`t o[?؀ ג靐9?'!`42㿘7y;<cT<    `@  T` #$a?x5a &#a!g(!( g.g%* * .%+`  ,` 9'!`&?? d ` ֐7&?`.$+'g   ' g $  ' b%$?b)g fجd~7   9'!? (((d.$+-+d+$ff /` -` @ Z - @ %  s?$``` f؈g$  `` [$ 4 $ `1``$$` $`$$ `D`H   d+`- *  $$@ᘔ  $$4` @  @`' 9@㿠; y<@++`cT - @.`@x<@@G@' `?`() (`?`# '`` `,- ,` `  V@ `I@  @ A B C /.@ ; .@ :`.@8.@@ :@F? ' $@ ',` H$+ @   D@* "@) &  @-&-@4$  & -%-``7?& ; 'a?㿠 cX. * *` `. ``/ `,`& `%`f( (`q$ y "P?$  =ycP `?` fԒ-`%,곔 ?``:/ `;g> / (!(`> > `4/ `5/ )$`#$ @౒ @''㿠. 3@/`cl.f -`%- 颐 y"cP? f fȰ+) $"+`( @?㿠; ^'Lyc<Y , @,#\*`P2N L`M , cp-`+ @ ܮ` yP a?`&L`L@@$`#$``'`L"'L  ` 1&!?㿠; ['L%y<@V/`#\.@, R@ `LLM @  @@@  Ē5y1P&!? LL`@ߣ`@$` $ ,$ %@ $L#'LL 9y7#P&?) %!?㿠; Jyc< F * "*  * ;cp,/ @* /(t(`@@* "!?@,`cp+  @   &@ܮ""& ""6 ? #a?`%'?",b,yW*yL)  .`y4.`` .`@  @. /+$@+`聐 1y-#P`(%. , &+@/ f ?/ڇ> `,/ (` - @ > /ԓ> /հ .`(@Δ  @ /`,/ .`%-`d />/ / #@+  >/>/Ӕ @! *`" *   +$@+`А.`( -%-`,7&? yH% x Д ;y cL? !$!غbT,$+@j$(?  @    ِ5 ]&? `  9'!P?ح-`%- @=$(+ #@ *촐d (!(.-&-@- )+*`$" +`)  琒(`".E -&- 9?'!zy#<` #<LT ` `T `T`@ T? J `r `w `a J `+"  J  +"  J  `+"! !㿠 /% ѐ!*  @5/`L.@㿠; -yc<)/  *#T *`@  )#\@T ` T @ 5&   9#L@ # 㿠i 9?'!;А &?㿠U 7 &/ @c\/`+W`   9)'! W`7`  "  %W`y @7`P#a&)^@Ŕ/W` 7`3W`7`㿘 1&! , 7\**T``  9!'! T`4`_#\#`%&@7 ``      `@ܲ&&` % & %@0`T`1y 4`#P$a``   T`;y!4`cP $!\@ @s\ ' ` "!㿠t 1&!?. #L*   *`  @&@@ Ր  T@)!y4@#P#?% &.`&-܀@ ;y9cP?'!㿘 ?ڔ 2㿘/ ?! 2㿠&` ?"  " `/`O` `  .㿠N  O`  ˒??O`Ò?"?O`` 㿠;yc<c<`   !#T$`#`*` *@ *  "%`8&?%` % T +b,%&-&@-`` @6`?&`'`0zc|   J )   J : J    㻠;zc|  ߐ N `/(-yԐx#/yxM `@8@@8#.@N  ǐ@@*#. 㻠Ӑ@ۢ㻠@f "㿠 `ǁ@ۍ 㽘 `m@ۂ 5T` %@ ``  @?"-` @Ӓ ` @e` @ʒ㿠 ` @X㻠b?N?-5r?@B83z?cx!cx +bgZ @^ @= :: $> + (`@+`/`" & J$ 7y $ 7y@/z?x?1z#x45z7y&x@x ;y /cx?㻠@e "$@㻠;zcx  9 $ O`A!O`ZO` 7y5{$Ț`K` ```K` @+``K`@>۔# *@ 㻠@e f @ړ2?㻠@e  @y2?㻠@em j@a㻠@eV "R  M @L㷘@e9 @e1 @Ò?; 'a' @"$? * O M`@/`M`㻠@d _@㻠@dߔ ܐi@ߒ㻠@dǔ Đt@ː㷠@d @d  5& ? ?@ٜ㻠@d} z`@ڔ [@՞ @ @Ϟ @@  #a?@؜ @ @7 #a?㻠g@'㻠@㻠@c "ג㻠@c "ڐ㻠ސ@0㻠@cʔ " @S㿠;́@㿠1;V @  `㿠!Ɓ@س㿠@ج㿠 @6㿠Ɂ@؛㿠ˁ@ס㿠΁@؊㿠@ہ㿠@ 㿠#D 7? @82? 1<`-( @;<`/&`5&? N `p 5<@׬iŮ. /.5c@@דŶ `"F.``@"B.`/`"=.`@":.`/`ڐ" #@,'x@ѐ 2?/<+( x@ʔ#x*Ox /x@/?x㷠@O`/#5cD@B& :.`.`.`O/ / /  /"* /.`.`-MԀ` 9~/5H@Ð !Ԁ@;a@ֺ<㻠f95@֫#LM;?``H ;5cP @֬! 96 ?@/?@֧ 㷠 А ?7@w@t-z@?@d?` @U@5%    @@@ % @<3 35   @)% 35@(cT@@֐ 9@X d@@I;j`l @6o  㿠;5cX@D5 --\@;x$-z5#`c@/ %52# $a?d@  -` +%a?`-~ 㫒 I ? /|Ԁ1@a! 5` 7@ձ;'c 㿠@է'` K `/  # K /"#  +  B ;a / `,,(?9! /ì,-?  㿠@z 㿠@j`@b` 㿠 @@L j @J { Ȑ`K@@ "@K@ "  J @ "    K@  J   { Ȕ`K@ "@K@@ "  J` "   K@J`   K``)  K``*   J`  K  )  K  * 㿠 ' 1{`"N@ `  J` `N@ `" J` ` `` /`   N@` ^9{ \"ȸ N@ ` M` ``&N@/@s N@`M`  ` "  /@k N@`/@T N@ `/@  VN@` @/@B N@9N@`/@ `   == ?> `0/@ /= ?+`?% :` @ :  0/@ = `) %0/@ N@`/@  N@`i`   - /@㿠@ӡN`@Ӛ@ӯ N`@ӎ  J   {K` ` ` K` J  ! { Ȓ`K@`  J`  `  K@@ 2  `K@ 㿘@~ J `?㿠?` @@2N@= 㿠@ =$@ Ԕ.  @` $. @`%```@@-.`@. @֐'@' 㿠;xa;x?'a 㿘@Ҽ;5ch@Δ ;z3xc a '&'r*   .`@ @  ]* " `.`@&``ծ 㿠@y`;z =@p;z' @ҏ.@lcI;z?'c 㿠"b O`"^ `x"` x c "h@7 `xb xc"@.@ `'`1x+5)cl'@W#p%@6q#!@;Pc@Ҁ#n @ "/x-c@` ` 9x5'!3@6F`@S 㻠B ɐ?" @һ㿠   ( 6-``" . ꀥ   ` @ѱ . s㿠. -<7`+@}`?@?`.0`? @v?`(1 5  / @i@j% @a `  @Ѫ  `?`,`7 @E `5?`㾐   x?x@c 7< V x~7<.  @)( .  @9 . "` ;cx@8 @ @2  . 6 W  6  & &   & 0& H  @.  (0 `, Ж ":   ; āX@'a    &`=`@#)  aȦ]$a `.  ?J .K`"  K`.  K``   㿠;c  `$  ``  `? N.  O` ?`H`. `I   J` . J.  K` ?`L .+`L`. +`M + c  ^o jk  @(`@$@b/ `w[/   `lP/ @  `@`  %M`. 8%` &N .`8&N`.M .2#?:/M. `?/ `  `' / `#/ `$@/4 `` `&`  &?㿠  `?1# & ! ``5`@  .)  `@ .+ `Ӑ5 5`4  w6` 0l` (b!+9<` x  'XX/t /u@f?&  C` <㻠-z@Ȑ?`3z? 2/?a&*?/z%Y3zY3zc@ 5z@   @@  2.  2 x>/?!x?,6?;<3 ;'a?x  @/  xȐ? <(@ `8? `@h`8'h'l`@'p'tU?5??` /<`-&` `@&``&;?a`  `` @V` @P?9'!㻠;a-+aԀ/@Ԁ @2. "35@ܐ 350@2~|735@̐cp ܐ@2n7t`7i# ;@O֒'a㿠h 9!;a`" 㻠/<-(@^# ?* 7  ?`#B$5   $  &?   &? 6  v$?ؐ?㿠; bX;@1֒b@OI㿠6 ;9b;a"(&@1@N >Z $?? 㿠8- `9<@9&? & ?v&? ?㻠;zc`azcO`\xԀXxaJ S R N M#zc!z #@ِz#xa@!'?@n!+aa-?as`] ` ` &`?@̿  #!?㻠 zO`  zGz?`+zcK &!x!Ԁ"'xL`/z-xc)6 3a ]" 7"  ;a " ?+ %a?㿠 ?N `"  @N .   `  `N`/`N`/"`N`  @N  `N` @M `0ؔ@ ֚@M `3)zN` /)zhh@5@t +`i2 N`  @8@@&`@)z#-zx`7z/zx٫3z&cx&;*aԀ;vaԀ   @M@Ł㻠#O`N`@N35 @Gcx@̓?;x  9575a5#|ㄔ4@́ @k   2  D ///_@M8??@8`4cWxc  ? "! ?@@[???'''@ M  ;,c8?Ғ ٢` )1#?#-@2? ?-  @?,`  '* x'' ,?,9z1z#x?&#'#xXXߐ&`/ :/@@x  x  ?㿠 ;a   J   {K`` " `K` ` ` `K` 㻠 a  _@/ ax " 0&  _ A(@ʗ+%ْU%!1!I!B`93I 9) ! )O`_`/"Oz/O /O`z/ OZ/O /@*  x @ 2? 6g=.)  +5c@   @H@ʿ /``.@㿠Ɛ1@ # @ђѐ ]@ɳh#\\` \\ " & \`"   #` #d   #`  #d  #`?#d   #`? #d  #`  #d   ` `. `#h  #p;p``' .9; OZ@; :  @`,  " . @@&: @" 6`6` # ,$ #p#`.&;@@)' @ `#pp`hp  )7#< @-ed@J؁@Pa#t#xth"@~#l  5l @I)@0t`2  2 #p@3 ڐ?@JtlڐѦ ʐp`t t@ȷt#th'x\` !-;֐#OZ@? :  @`+`  `/5@Ȕ㌒&`:``3c;;`OZ @? : " *   `!5&@y#`= @@ t9; OZ @:: #`)   d@at&d<`@@ ## #|#L#` ׬ l& #?` ##€\x  \ \ "`.`\ `(`'` $ &@&@``F; OZ @:: "*`  `@@@@``+;OZ @; : "@ (  @@@@;<(`< `  ;`) `&` 8 88'@+`# `&@+ "``t h %d#`##| #|L#@ǭ6```;OZ@? :  @`+``  @ǃ @ ## ` 6` "p@sp`t t@gt. <ﴐvl `"``@```@?@`@:㿠F`A9yyʒ ƒ   f ^^ @?   @@ @@ 㻠`@ 넒 뀒 @̐\2% (  /    - @Ɨ@ƪ2 N/ @Ƌݐݐ@Ƃ@ƀ㿠 O`R+? ? @EԘ   J   ." * * ? ?O`` *  .* ?1z&# 3z&c ?@G@2 O?@G@&7z㸀&  9z #㿠9z#9z@#3 P   'z `G2 'z` = $`` 5$` -z* M` /z@~@ޒ ??@Gx?ܒ &7 ? @Gv?< @ )z# !;<- @  !;<`` `'x9x"` c"h @Ń  [c@)Ӓ@ŀx @& @/?@.А`/c1@)#'- '+@)c' '#@)`'% '@) 4'  'ܖ '@G "\?z ` ``OO?@@6J ? x }% L$ #"@)u`X ? @D?".?@"@3&  @ 9x9x "89c @ h`&7? @F? 隒  !&L  x@Ŋ 2??@F?<( @  x- 95@ƒ#!5@ľ#'@[x 2?`@Fk??x@N % ` ?@FR?-  ّ2  ?% ?@F>5z` &3x-xb+c)'%x%ِ `h@X q [ d@(@W$@$ 1@-۔?@-@( 'h`@( 'l@('p a@(!'X z't? '\ch'`X 'd@FŔ ?'   '` 㺐xK x &?㺐x6    x &?㺐x   ?0귐?6?%z!z$$# 1z?-z)z%1z(%##;z3zc@ôc7z@í &㬁  㿠  x㿠  N㿠 %   /N .;xN  /" ;x7xb5c3x-+'  h@` y [a%@,?r ]@'a\@D8;z'c? 㿠 7  ;a9@'!@Dx;z'c? 㿐@!  9x "h"h9c 7x@  `@ 5=`# [  @, ]  3  :q"(@'H@,N 2  8 e@'<@,B ]`@ܒ 6>%/zP@''@,- 7 ;`E @vϐ 3 : 9`@vܐ0`@¯ 2`@:  %@&@, 0`@>`5`_@; ? &*`" ` *@* 'c 6=` ``@z 3 ;& @&ǒ@+ 2:```;5c 1 :` ؒ`  Ӑ`@Rx}9}".`;} ##`3`+z"95'b;5@,? a7@6  a  ^ @:` >% (#) (`&@?#@9c̒`#\`    9x !7}}3`@8 &"bb{@+͐  9# 4 1 ˀ π 0"z ' 1(t  7' 4`(l ' 7(f  t T  9[ AE D"J`쀧 L a= d"B`䀧 !  t@!!" ׀ k!"Gр $` 6 À   ` 6    `      `   ,@(@    5*  Z @8:#." u  r  n l  e $ a *"\@ < :"@ (#S$ $ Q N$ L F C    ) ) # 1 4) * ⫀X @ :`8 . @ 쀎, *X @;8 @) * 2* 3` 7@ x7!08` ^@tဧ  29x`%}+}} $%b"@*? 2O #`0O/`- $ 0$`F6Od$OO `0.+`@% 0$# $OO" 0,@-` "`0$ OO! 0((`#`0$O`O'`0-+ $`0$OO%`0* *` 0$&>? 4:? &6? 42?4.?`;4*?;%z\㤀%?4`?$``2 `  -?4` `2 ?$` ?;z9zc?#'''x㿠5'D;}7}b@q$ ? 8 ?@)22 ? (` `"@x` ? D*  ? * @Aΐ "   `$ ? `@A$ @x` alސ ?@A`"V @ې zGx'%<` :@̒ߐ2@.8  *  <  `;` *r&ꅐ-'@& 䞐` 䎐#t#`#p@).#\?7x;x)c$ bh @h  [N `. N / 5x5x%@(?n ]t`` #p) p  #d' [ !z?$#'z$p p  zt@?@@`   @!`@ @ zpz##l#he`b #x)xp+cbx!`bh [ ] `  t`pq t  ?2???@@   t`X  `@#`E @Ēݐ # @(N?֐C @ &p@  -`@`@`@`@?@㝐@@d?㫐/t#)<@(@2A? d@䡒@@D  @#@@4~nl!z-z$#h%` `@?@@\` @@\㻠N .N . N @ 㿠;a -+c- { /x3c8 `@ z`c1z#@aP  0@"\bL&`  9z '#5`#Ò  z "#❒@s` `@"2`<cR%,` 9`.  1z``* @? @`A  `+` θ `X @!`` ,@R`-`~`. @?R?@`@   K㿠;a #*@ ;x9cb8  @\ 5z`zc@`  !$@!# ڒ'  `f   _1/z %-z)z%'#%#ᬀ7c83@!p`L'`*` ) C `* @> `+@  `,@@>ѐ?` '``@& '` @`@ &    ʺ `2 J ` " J   J " J ` "  * H-&Ha) `Q <̘a)4   * H(*  H* "0 H `쀢 5H`1&5 H941 H" 0H) `33#)`̀   * H`7*  H@* #`0H @ 쀢 ` 2"`p  ` Ԛ ?- 8 0- 1 ,&g^@@? >`/ ,`&@`0(@`@ 뀠@ (@`g `   9J ,`* @  `&   0+` ``&    ,``` `N&-``%   /  .㿠N `k 7{N  ^ N ` N   P N @  'N  `  ' A "? N \ `N   "  N @2 N  ` N \2( N @"" &  ` "" N 'N `"N ` N @}" N  N  㿘//㿠; a   " @Z @& `榔㿘 &` l'J `   `&`А`% V'J  `. &J a) J `_  J !) ` K``_`a)K` 2`K` _"` 㿠 ?`J  7)J `_" J 2 ` J `0 J 9 J `?J  ` ?` L`=?L, ` /  @ '`呲 a㿠  L N`H"@ @M  M @|  `O`` O`@q`8@o@g@̔N  ;a8.㻠 O  .`?` @=@7%@1=޽N  /N /@ې@@ .9ސ!.㳘@E J  `~ "/N`! 9575#ܦ \  "N`@Ր /N`@ΐ,`N``,N``O`O,@` ,@㿠;5@c^ :@@] 9ߒ! @А;a@㻠"] N X⃔ "P N`"L  :? @k`@e`$@``@_`L/ &``% M `/"&``@_ `NN/``"  L`  㿠` @  @㿘. ..`C 2 ` $.`N [ 12  .O``]7` N -"N ,N `:N -%N !N  ,N  :N . N . N  N , N :N  .N -" .L " L ," L :"  L >``@-&@. 㶘N`  ` {Զ#\`"Ȥ   ^ ? /N \"+N/`N  K `   N/(€`N  "(K` `"( N/(`N]H )!- {$Mx8W"Q\["o ou ]" e` h%aw"\~KX \/$/x`Q"#p`@i` f`@@ Nh\@ .X`* U`@ #2 $//K`܀2M?2=K`:`7`讐"1\ ~/.`//*`(`N`0 N7N"0/ J 0J`7 OJ  (@# 0//`N//` ZN`  N`.E`N` N` @   N``  .N`.1`N` @ N` `   N``  .N`.`N` `   N` .`.  `. N`` @ . N``FBN`=; 21`N` N` `  `  !`N`  N` ``  `N` 6   ` `N``&ʸ N 2.㿠N `/`&`N *ҁ@ᤐ  **  @J `*" J *  J .J`."` @ 㿠N N `? `\ `@Z`Fiq&`^"?`k&`?N0 N 7 N$0N0oN 7k/`N``@% 0b /{Mἀ` ἴNNN`O@ O@KNH?Nx$ @ `?&@?`_4=?'`@5 ``?N%) )?N$  !&-z `@u ?  ?` ?- ?5z@@"N2?! !!"!bg F* `X @: 8 # 0`` +`* ``@*  0)  f ?  )@    @* ` `(U * z2c `  ?  ?` ?`)   {b @ z az# ``{b `  ^ @(  (   \: ( ? (?8":  0 (:+ " `0( 0(  (  ``)㿠@B N b /{-xἪ$  N\>N 0N`7 N $0/@H`0AH7=HO@#0,` /@2N  O N@ O M M/@N/@N`^K   ? _' @ /@N/@N ې @C.@`2&`㿠.`ː`  `~ 9{7{!Ȥ ^ \  NM `@ N *`N ` M N * `N  N N*`A N` JN J`H@ `*`H@*' N  `*`N@ * N``* 8` @ 9 0*  @8`0*0* `*㿠;a6#a / c `'6@@`@)6 @ ./{@@ 9. x@@7 @㿠+3{b%```%` `E %`` >9x"`9 xbL ;@rbd @5 {" )"x"" #x "``"`b;@mc۶ 9}5x'"1}-x) "t'&`&"%@G⌒@5 ځ㿘   ]?'%~`E ~`נ   ,  ,  7 @?`2@`' ?- ט&+ ". @ , @%$6 ט`   @`,`,  - ߺ$ /`%(`- ` ÐO ,- %ߑ+" .- Ք @_@]? :-    K@ 0   ,  : Kf  ," .  @@?   *K:7 p @@?  -- K` X @@?@ܐ ׶ $ @@ʹ ۶@&`ݦ&- 0 @@?& @@?㿘   ' `a~` `@ `   @|? :@u@` ?,` @f @ @_`@W %@6S `@k @ @  ,`%  @-`@$@ `@&`M `$   ` N  ` '`/  t ?㿐;6-~` E. '@@$/  &@ђ- @`?א /@ɒ?۬?ߐ @ @ "@@@  "@ ``!6 @ @@ ` ^  @ ,?@?? @ O@@ݒ?@@  - : @ ` 0@} `1@  [@l  "@ ]@`   '@X @U '@R `@L  "@  , '@;@8 '@5 ,``` ?@  :  `?@" ֖@e ,  ?   @ :@ `@O㿘   ?Ð   ~c    D @ې 5;')~ `   7~5~E` `,`@,@ѐ@`> ?9#7ǒ@ ;@c 㿠;6`;@ a@. ' /@ᜢ` @Ғ @ "@~᠖   "@Ò "-@o  /6$ "@@@a㿘   ?#   ~c   B  @= 4;')~ ` O  75ᜬ` _``@@3@` ?97#m@ ;@c 㿠9  @U`>``>`>+aԀ @?57԰/`&@Ԯ&Ժ>㿠 >HE39.b$&>@a!Ԫ%'!!Ԁ@!Թ.`7- ` ``@V `&$      #*`$ ``6`$/`6  V   ` ?㿠 ˀ ʐ`ؒ  Q!!R  `a R ``  ? <,`W@ ` ? @@ x  @ t&  .)! @Y8b' a6 U`& @ @`@ja6w V` `` ?  ` H; `  `  *?!-J` ;@& .Ḹ  @ '  ,` o  ?,`T   @ , ,  .  -6` `I ? C ?㿠;6/`(;@. a @V @ @`> ) --`@ْ "@b$(@Β "@|! >  @s +` + @ @ 760'@ $ "- @@@Y㿠  ޔ ?  *P᠀ S ᠺ````> >& "  c #@)  !6`V``0;`y ` ?#Ta  9!T@  !T !* 1!U` 7H5@ ;@nc `y ?㿠. ya( @ @  ,`@@    @    ,  &㿠/y?(( @`&` ` .  y!@     4 *"@- -y % @%. ,@s$@,@4@ 4@ 㿘   ?`x#$a)N ` ?` |  M`, N, "sJ n@Dy a( 'a(``` 2 2`@ 2 2 `@d  ` ,,@ ` ?  `u ? m ?`? ^ ?;xa 2" 6 `P ?J @Ԑ?B @̐?: @Đ? ; 7㿐;6/y`4;y@. a$ @@(+6@ )y@ "!,@@%y!y@˒`<.@ƒ@ . @ ,@l @# @ ,@a!0@  @㿠  ݔ ?  y(J ;9yc!(   `@0` 37ya( % 1x/y-yc#$$(    ` K `   r @ؐ  `` ` ?7@v 㿠;6`@@< @ " @3 @ "@ߒ@&@@ԁ㿘  [ ? I   '1#  ` @{'$z',  5zi  @['+` @ `ؒ ` ?`!?7 3c+lc)@Y @ؐ# ` ?`M Д  `Ҕ   `˔ @U? 㿘   ?  ` ` ?  ;9b@u@{  @n$@t<" " 7" -<1x/c"h@ /<7_&@/ @`@  `@ Ā Ð 㿘  O ?{{R Rb `ׁ```8 ?s `+ ,`16 H1{%"   @ `C@Ғ@ϒ@̒@zK @%`@ 㿠   ?+z <c0 `@u``  ``@2  `I= - ``-`@ `Ȕ ?`#!@ @}c#@+ @  9 `# ``  ``@`@ߐ`@ 㿠;6/`L;@J. a, @0 "@@ @ "@@7@㿠  m ?   c   {""ǐ@Đ @= `\J X!` @Ǯ!,{b b``@Ԕ`` ``! ?^ 3'c%@ @    ?` -`-%` @@`a' `]%` ` ?㿠  ڔ ?`  ?{b7751b0,!4 `"" `@H @E #`'  @  @[ % '`%`%  ``@լߐ `? 㿠. ;6`T7@B$ @+6  @8``@4`@( ` 2` ;; `( @В``@@Ȓ@Œ`@ !69  (@ @@ `!6 h@㿠?`퍢 ?O` `` `"L?O``(2H?O`/```,`@"=?H )29?H`,`@ ` J` {2(?J``2$?`!`  `@u ` ,``` `%   ,&@X  -{   `+@!`@ `u& ` ?7{┮ $ ┠ `@\`   ` `` ? 1## c9@ߐ @^# `  J  ;` u *  Đ%` M ` }_N .ҩ, !? =@``, ?/ @ `  @@ @`% $``6o  @`` @   $T?  @w`@ ?` / `M/ '` $`  `  @V@ ` @M,$`     `%@  `,%     @/ @*?㿘   ?& '`?2` ?` x ?`` =@@ ѧ``@-@@`6%@K& 㿠  @ ?`о `?3?㿠  & ?`ْ ` `? 㿠9{ !@א ``?㿠9  @Đ ``>?㿠;{. a ƀ& 㿠;xa쀧` . +-` @ ;9@#6l7@b@ c@}#@+  `c  . 1. @+xŀ5&b%   '%6@Sp#@Oc!T@ h#8@Hc#@  㿘1.??&!긒2? _.'`xb'`f q?`2 m` a_ x"al@ @' S*=$'`x""1 <L6`4 #x$a@ c@'h (M+a) 2'M_'?@ @I` @|Q㿠.9{! ``@2` 2(&`='``㿠.9  ``@^2`2&`'`>`㻠3 N`.  J` $ @ .@'@@@@ @c@ 㿠;bb #{bb $0-(4 b    $`$@.`$@$@$  `*`"`'` ` %``(@ը 㿠ꯐ@#- @@`% M  @  ." @ @ @y# @z`ߨ@n & 㷈#`#d #\?#\ ?\  2  \1 N ` /x $ c  N3% N`-#hN,@N`\`O` '  `N,@``N@ `N" N 'N``2ٺ`Nֺ`#h  NK "C0J{M"c`T NjPR"i\;X" '`% 5Ԕ?d? O` ` TMd? r #hnO` A`` `?`W S,@ `\`S3) H D5A =O` @S  `E `J" `` $@@ ,@ @ Z @  N,@`N,@ ` h`" @` NcN  @$ `$@@H c- @  # ,@ .`@ dƐ  /* *  @ d@@@@@`@` \W  `9#`#  ?? @ +`  7{&Ⰰ`{Ⰰ" \/`̓`@.@㿠;{b  /{-x%)}%`%"  3{@" &b?@w`@ @㿠А ?  ;x7'a5@В @$B @[ 㾠V`~/?8  X % M@!`? V  . O.V &O% .O.O !  ..ֆ@52@+@!"- N`@ " O V @  @ ?ĸ @L?@#㿠N  " M `   M " M " @2w ʔ 7<){@͐O @Ɛ㻐;{b $`  ;c +?%aa ?c    *   +`` /{ %/7&/R􀦠 /` `"?$`?`" `/`ۖ`"?$`?W7cL@>  /e ?  @4 V`O؀֔`АC {ⰀW+@ _2 , (  `WF    4 ݬ @ː%       `+` 9 '!7&Ȁ`2$`㻠 $ 2   $ H $c @K  +``c`N0#cN9cN! 0!(J`c @ K-` K`c` `,@N`(@Nc @N.`N`c`,@(㿘;{b``  -$ `@l ``@&`@ Z8?" (-`@ *?; `(@Y<@ ?   @4  @$ 㿠;6`t@֐" @А {b ba,@۔2 L@ ``,  5@0" @_` @㿠9{/{"✹.  . T@` H. $     #{+{b4@4@` {"@U <*$ U`*   # 5`JN``F{)@#T44 ){"  "  @& .` @/ ;{b & #@&  &`  㿠ɒ ;6@`x @ . ?7{/{⤞U@. %{? ɲ+`{'`"5@ 5@07-{3{b@?U``5`@5` @ "  "@! #`@͐.`&` 㿠;{. b [  VɄ U-6@|@` ?{. ⤶@1{V" V {b  03{. b%K` @@i" @5@E@Z"@@9 צ$@a ?㿘`;{WbN!'wN =6N@3 yg?`$ '%+{%Ub$'&&S{bN& +6){`"N@N " `K ` 2``@N`?& '(`@* @@'&` && 6  1{",@?& 㿘o '  N  3{ bȶ ! 6/`kN2 N `K `  N. `'NJ @  N. `'iN \H``` H J`  `N . 'J`FN'N@N`!:'.'/ '. @Z#6`@U@# @ `/`ے@v%N. 'N`V .  ;9c@'#@Ր @@㿠;{b % .9b!, @2y2Ǖ&Ǫ`% `㿠;{b % .9b $ @Ŕ2N2j&`% `    {J bȄ   {J Ȉ ` `     + { "J"< J`  J `J `" `J@ ``@ ܆@   J{bȘ  J{bȈ     㿠 m`7`Hy2b s [``i2R  c K`[CV> Q2: $K24 (E2. 0?2( 892" <32 `2 @*2 D$2  96 @2  ` ` 2 {b`"  `| `2`~( `1 +`  (`3  @&   @   !:* (`  ! + 2*`3`: \\ ` @ 6* * 㿠`/|`ڴ`` - -  ~@ .}5}&`,}%}-`'/ 4 * 2: ` `. . 㿠` 6 & 2 5{?Ȥ`@  .`@.`@  @ @cN`.`N.`@`.@`@֤㿠``3 &`/ {`b@   ` ` `@. @  ` ` @ d ` @ .@ آ`㻘;{cȀ !{#K` '{%#6@` @!#@  "@-{.̰5``̩-V%``@@@㿠;{c̀`9{#7{@u &́*  3` { c֗+ ?" * @& ` @   ` +  ?(?@@ #@ +`2(0` 㻘)}"܀`?9}"@S-} %܁. <2 /?   & @. 2 "`  "y "?&@-`6" " "@& (0!@&fK@{?  ?;?c"  *  &    :; b?.3`@ Z# b@.3`@, 4 (?c倦4% ?{̀h̀`'; `` * 7 `  ` `*.`5  `-` 6`  /`+`3 ` `1  8,* 0`5 @,``+` -7   ,@02`8(`4 ,@7 2:.`5 ހ@/`, 4`g 5+{cȀ`'{N !{##`-6@8 @F!'g`g@{  " g@<?'g* 7``3 g@   ``p* 4 g@T g+@+ 2@   `,`5/`.6`  ` `08`* `,7 1 `=:% *g@R2g@ ,/ +3`  -`1 2`8(0` -`3`4 @; *2@Ӏ.`.6 ? ` 3 "/ { ?bȘ` @   `*   @ ` ` * `*   @ * @ `@ ٘  㿠` p &l .5{/ ȇ; (;`  $  `@` ` ``.`@ . `N/ .>`N.:`.`@ `%   ``.``. `. `@` .`@ ?.  N/ .`N.`` .``. `. @`.@ `@ `` .`  .` (.``.㿠` &} 5{ Ȣ?`@"m`"j ` `$  `Y (  ` L``@ @ @. ?.` @  /`@`. /)@  ``@. @  /`@`. `@ . @.@. @ 㿠FD\A   + "  "+8'`" '` BD B'`'` B B'`㿘#\'N` O/'N2㿘 #\ *㿘@ː* '/{'@ ``#\w  /@?'@㿘@* '3{'@ Z`b`#\R  .@㻠'H'L'P'T'X@H֐㿠'HH+`H @h! H@a HĖ@XH㿠t  9x"  ;`;`В@   㿠 +} %c5}1}/6"@^Ȁ }  @ &`31x>  . Z&&`&1x`"1x``" "@!   8 # @   $ 8.# \@ `1x%%@ &`"-`"@ " =X># "`$#\  .  ```, ` @B&`5` `@A-?``@A) 5\&&x#h}`\#lclcll    %6 h֖  `B { bȬ N 4N @  M `  $2"N"N'N``NN=" 6N@g耐"NƬ@ `1x;c"8 `@O"  `L "L '2#pL#p``` J` "J` "`6N@& " &@ސuԒ`l͐ '( #7 '@ `xE: w䗒~Ƙ `~x:2 @ʐ@ʐ%x#c8`@ "@ @ ~ې   @" xB2?"l@" `$l6` #t  @&@ N#xpJHL {"L@qtL @ " M`"L L $h h#\ "і#x`.uT "|hh@6 ="`:7$ #`#\#dh&@xh#\[`.Βh#\H / /.A#\#`#dhx`3@. @`@h#\\.h#\ I. z@4 3x5cb8 @/)}"`  @ɒ h?Ԓh   @`&@@㿠\!}dhmB`#l7}p" &p m`c-`{b \-`!{"S 6V1x("O1x `.&% *@ J ' {{"bȨ   (K @ (````.K@ (`*@ J `.@&&```C$1x3c"8`@ ``$`@ : %@'@ : .7 ^"2%%%S&`%?`"&`㿠\`dhl}#l 3}cp &cp3 Ֆ@47`2" %   : #@  #  :./ ]"`&`o%`lO`&&`],`{✖  "W7x`$S7x%`$6 (@M "4.{{Ȯ  + J `  (````+ J(`* N `. @*@!$@&&```N7x1c8 @ 㿠@ %c3xb8@ N  I {Ȭ `  .#\N{"Ȕ ` ` M %{Ȣ @`N``  ;x9cb8 @Ò   #\N  #\ #\(&N㿘\!} ku "K`~&"H!{6"ȬI@K `"  L  `2  H`I! @#\` "&`` " &`.@V#`#\#d`O %x!c8 @=`&`@&#\`u&`` &`.```@"`$`@ :%@% :.3 ^@",㿐%{\` EB : r"`){r@ "Ȥ `( #\ #``E?/ / /`͚ ` M?}b"b` &`#x9cb8 @ j %{Ȫ `   U!{"Ȫ `N -:q` q ` `{"2  /x{ `" `(x #\#``/  //`m ` ?}b b``&`'x%c8@M j  ` B ?= #\#``1`&`. `q`,`$`@ ;`@%@% ;`@.3 ^@#@=xc8`@iX#x!}'}\ ?#|;}b#t"#l$#p?}#p@' '   /@`'4' ? i'{ '###rD x}q #ph쐐쀥"J  @ "wiqn  #\#` c'x`8@ [  ^`.`'C @!@& <%% <. Z$@`. `' @&  = %  #@  =.+ ]@%a @ :pN`}{"  2 :` ` `:`p8}`}hڪ #\ #` p c'x8@ƀ  \`.'﯒!& <`@ " <` @. Y$@<  ?:0@!&  =% #@ =.9 _%ϖ< `?/ ?$;;` 0T!& 9 !"@ 9 . Z! < *$ 0(@1@&  = '  %@  =.' \% s cl!#!   N "ܨ #\ #\! !!" #\M! #\!O!I !v!H#\!J#\b!W"#\!bY#\g x9!%@ $w?  xc8@ܒ #\8g -%x##`%$Ls?` x9c8 @ h#\]gx Y'gt'Qgl  xc8`@ D#\g1'gLv&'gA /xc8 @b   'x+xbh}cbb b`` " @ $  #`g?@2 @@ o @# @M|#`#d#\#h#`|#h#d#\>f #Cf` xc8@ْ  x #`#\ |x/cb8@ u@''i@& 8`@"@! `8` @. Z @ `MK?ffEp#`#\˚''6/ @&  9  '  %@  9 ./ ]! 2 ? f+ #`Z ! ! ! !pɒ@:e?f } p}#lpfRt5}}&l#b7}&p @ "'.n1x&!㿠}`  􀢠 `#xb @  ` /x'{☐ \  `%-`%;xa9x!&& 4 㾠}c2'`nE``L` lؐ 1x)c"X %c@ `'x `@ lŐ ;x9c bX7{@ 3x /cb`-x@ +cD`@ 㾘#`3} &ct/}􀥠ct)x"%`$ %x}b }$  %x}x%xb@$ /} % 3xb +x-cmؐbh@W  m#d/  0 N ~# N`6{,bȢN@9N ` " L`@"`N`N "-  2N`O { \bȲ N `   -75N L` @  N-#`!N  L` @  N`- 6N@ِ!D-6N`-N``-6- " d+x#\a% d  %N  %kƐL"} 1}/x#x@@}#xm  xch@ 1}}}blm }"#xb &@+}b  3}b/x }@8 } b @b` % "N aP 㤒!|@&  N `  &  "J "& .  O  N`"N.N .㿠9x!  `3 [.  ])`&$@O? ` ){O@"Ȥ ` `&@ 2" d&@@~㿠;x9xb7c5x3c/x'`-lO "h+x@~͒ `X)c@~Ȓ U?jb` @~ lF㾠'H'L31}'P -x'T9})}'X@H%ɐ"9}"a&" r?%`%"cm/} -} (@`%l l^ `n`N ` (` ` " %` `Y" ` a `n`y"  ` " a"  `   `   ` ` |` ;x#xb!c$kː bh @~J }}bkk}}#"} ""?"!㿘;}9}b7}" &!x`) @  "'x 'x@~'x'x$#'@~̐ v?6L@~@~%c8#x5c@}b/}-}+} #kl xcbh @}xcX@}@}}"bxx"!  b`@}Ւk]bj/ %䀦 %%b3x@6b/x-c+})}& k: h@}b"k2k= @};x'a㿠-x'c)x?%`k"h @}  ` ! 3 `"*` k"   `2 *i"  "#xbX@}o!x"`@}g Ѻ`㿈%}#} !}#hb#`#d$"'?`* .`#\`$ / \?%$M A ?K`Z?H`%@}0 $2`$ ٤?  h-x },xc%#"#$#t#p#l&`}`}#bjpj{aĨ   , "> S 2O z6 ,`sn$i&,b$]   R ! IF 2 %```j#  2 *h2t A,Z*`  \`@@  (`  2 %`` i"` `2 *h},l ,``@iӒ! xpX@|Q`@- xp`@|H``@i&x`xb`p@|:`@ 5,h)}}} %"d##b?x `+x&ilbhp@|` .,?``& e `"``  i|! `X ```@{96!PjaD} `  #  `   `@@6 `% ``"``i< ` ` ```@{6aT i͔! }}bii)@{@{\㿠@{&a ` %6&aX@{  `-)  /6`@{ a ;b9̒"56l@{ a ߾b 16!t@{} a b( ߰",6|@{o a 4ߢ86a@{a } `@   `  '}+ #6@a@{J /{` ` `@56 @{<  ;6a@{3  㿠;x7bĸ`&&`` '1%"@XXː İ`x+x#`)xb#\7c!฀% xJ`%x@z#xa\%'` h[ f [xbX@zגx6hax"`@z͒f ]9!x)'!1 ``h= !"h@z #h!#dᠨ ̦Ġ Ȥ `=o`<mx2`@ =`\h!x"h@z`` ` `"U /V` h  @2 W` `W` V` d @2 W`ϐ `W`  ;f{bh6hobl㫐fop ޜ/ ``> `=Ę` 0 )'x!Ġh\  `` @& `g  @z\```# "@  5%t_Ґx76̸ @z  T< 9  -'&`q)6?&/`@y!Ԟ&a``` && 6O??`&&`&`&`&`&` &`  ?LиaԀ Xa66@y@z `#`@y`@y`K /" L "L`/ܒ`@y֒@y@y~` 1&!?/6-6@y{@zm܀ ```@y @z\ ``@ya`5 &?@yk @zF @z? @y  i ?Ւ '`Ao  dPd\!p"^X#6@yNa"Y %6X@yG"R '6X@y@"K )6X@y9""D +6X@y2b"= -6X@y+"6 /6X@y$ 16X@y""& 36X@yb " 56X@y ( 76X@y, 96X@x"42   ;6b<@xdP h hd"㿐 ;xf bh;c/x`%6@x #x5`@= $e@a3;` ex2`@ :   @    d6LؒE $ "d b; : [@ 2`@ :9  ;` @ ?;y d'c( P?&&` h hdl&`h`hdt &;y'c(;y dP'c(  !y$#( 9!Ħ!Ē``eecxhh@wc?2?ȒPF?(?T<?X2h h d   lc ,h h 4d 4 Hlp#@L \hh dd d |t7  Ӓ  d ɒ Ю Œ xٖ'x""@ " "dђ  @wO`&%  ۘ! 9y'#( 㽘N ` N ;5y $N @ /@`N/@`b N N`;쀣aN;  ;` -/@`N.@/@㽘;69@wbP ˒ M36b\#@w  ` ?'6` @v 3y/$$ H``` @-   `/@ 096!"d @v֔ 4567h @vʔ8   '̒ ݐL L D"  F"  # L` , J ` " J `   J ` " J " J J J ` J `  M  M M 2 M  - "L  L "L` "L~ LL L` L` L` L 2L,@v)L L L "L`  L "L "L @v=@v   " $`L `*`@vL `L$L`L L L  L` L 2,`@u`@uݒ&`$`@uҐ'`&㿠 &  ` @u`@u@u 㻠;~`;aԀ5 7~  `@uѐ  O``K 3( @<@u " ")"M L @ +  o0`5`@uB"%` v``@u+' '`@ 㻠;~9`!Ԁ)~   @uO``@u< "   ;"@$@t$$㻠c6 s@q'@`~   @t `  @t?``9 `@t֐ `@" ``$ `c)" `M` L`MN 2’@ `?@$? 㷠;~`Ò<7ې @t< : @t7 : "@t3M / &?%M/"&N_㿠ǐ D5ز" " `" ` " `" `" `" `" ` " $" `(" (`," ,`0" 0`4" 4`8" 8`<" <&؁㿠'؀ k        @sڨ  `  @s '  ` (   @sː" @s '  '  '  '  '  '  '  (  (@s (' ( 8' 8 <' < ,@s ,`' , 0' 0 4' 4/ $@s $@s ' ` ; $@sa $@s9"ؐ@s@s}㿠N ? ` a `'&!6  &@`-6lL`@sW``    !6N@s@"p  #4*?2  %N56t` M @s M  `& N``?&㿘.  ? #H%B ` @"`@ 7`- @  " ͒ "@$ @@@&x%? 8  4&@ra  6 . .  O `@r?@r" a* / 6 h& t@rz  )   ` , O ` ! @*L 2L -+3` * @ 6 M`s 6 M`s d6 M`t` 6 ?K"  bLM@ LbL` ,  6   6   <   @6  +<)  `.    <(  .  %?" J &  kؒ?2 & ͘  ?" J `&  ?l>2 &    J  &  %6x@q +6'b|@q   '|6b@q 'q6@q6'f"@q '\6b@q 'Q6@qv 'F6"@qk ';6@q` '0'6@qU '%%6@qJ '-6@q? 'Ԑ  %''  6 ' ' O ''3* J '% x!@pܒ :''耣@  $ %'''쀦l lg' d'"l' (%'N :ؔ;'N :2'H'; '''''''&      . @pw 㿠;5@pmaԺ/@pi@-@pe)xԺ_;@pb'c%x#c!`]Ȑ "h@pG \` `X@pA \e!xc``@p9 x!"Ĕ @p:]J` `1 J@J "( J`/J@`/J/   J /@H``/ ``H / JJ@  J@ӆJJ  . K@J@ "% K@ /2N J@ /2J @H`/    H /@ J /  J `/  K@֘ J@  J@ / K`/ `K` /`    J@ ` @ H/  ``I  `/  㿠  ] S9#N` /`N`/"`N`E @ "     " ` @{`@ @,` @o~`@+! `]    - )  ? `"? @2.?? ?@@oK ?&?@4 ݮ  x#`   `ʪ ?@$1x" \y\6@p#\@n` ??` #dc ` d`@$`#d ``  \ @nҺ`` @ &\'  @)6%? $?-  ?-`   `' 7\ؒ .3`' Y.2 -3`@n @ `*`@n@n``(s@-`  d@n~ e אH@F`@(? * @n? ?+`  ) @ o2 ? ?.  @ * 0`? (#? ?+`  ) @`* ? . #@? .` 2 `' @`@n+\@(? + @nD? *@ 1  ' \7f`@o\@n @n `$}?  ?@m   ?` ` $` $ $ +?@ ?@m&  $  '  ` . 4`?.2@ 3 /` 1  `  ' ? +?@m- a?% ?4?.`?, @n\'xb" [ Y"[$x b$] $?  ?@m` @  ? 㿠9"` 75"4آ L  ?q ?  4L`/?H  ?@mz ? "`p`[  J   /  J `/"   J 2Z` ]Ҕ "Q`` ? @"G`/ @m\`  `&1`  ?-`@@m-   + "   *`(  Ч- К` "9  / ̴X@% ' ` @f` 㿠5` @l'  ' 6 *@m⬀'N N`/N[W  ,@@l. +'L؀`؁?@l+bג@J`/ "`@J`/""`[ @l@l/  㿘5~9~ c  ?`! 1x#) 2&\`+`\]&`,`,`&'?Ѐ +@h '+b8 ,7x/c8@l+ "( (` $` *@ޘ  `,`@  Ѐ"p `;. b؁ 5Ԁ  $$@lЀ Ԑ-&`$@kM؀` Z@k ``+  '*b''''''''`   2q+`'  ܨ @kД  '''`㿠22`O /@ka: 2z㌀ ) L#+xaԀ 1x!M`9xt ` D@koO$`Z!@kmZ * * *      ;a@k\Y@kX㷠9~   ( 3xa   ?` " `2% [[Δ[%  ``@  @ ?a@k"؀  $ $@k e@k @ +/`b)%b!? ʭ  1"<-4T짐;7'b @j 2 p#\/~ #d #`?( '+x᤮aa`" 2$[8[P[k$   ` `?'@jLd` @ ːxX` `N`` bdŒ"|ޘj% N`6@jh N`6b@jV@jN   '؈!7ކ%% %%%` `Cp ِr @,  ɾ\  "E⬒븐`#>aԀ )!Ԁ2 㻠; b؀bؔ2!6@i"닐? `0 a  `,` ``,`, @) `0@  $`͘$`0`  `,@  `,`,@`-`,`, * `0 ՐGՐK؀`/ظ O /" ` -x+c8`@ia S`Q`O  ? C` +`'`0  `,@ "`,{6 `,.@?`0 `0``,`8(_ `,`8*`?`   ;b `,`8. 㿘@;cc  ?@ `  ??@  (`  {#b /i &?t@hǐ  `Y `$   ??@  -     h#h#p#t #dp`#` `  dp/ #` `` ~~?`   %`xc ) 6,  2$`X`YY"$ ,`, `,`. $("(@d  #p#$t$d!#b#\$$$  `ʖ d& \ `-x%UU6b@i@h23x Ӑ?b7x;c%'#`+cUwxc"h @g `X@g CI)x"``@g C`Ul  6@4   @gҰ    hXK?  #l h ` $@ @g`Z@gVX;@g``d* @g@g ( -@ і @g  lX2@gw`@hu@gk`@gfX ld&?\?`Xld`\`@hV  $ @ 4 )" #`"!#\<! x #x9c"bh  `   |#@ `@ @ ("\  xag-`#^@ @: >`$xaT}S`@f   $ &@&\36@f@g/bU@f\   ``  !x/!g,`[@@8;`#' 2Ȑ> #d]#,!<`#h@ L@f@&x @"7``9\ x!;bg( X@ @; 8`' "x!"`T x`b  `' " @ `h  ```|d ` !`\` !x!-g-`$@^@:> "@" 7x"  S`"Δ Id⠀`x"g+`# \ @:<$@/x-'`% @?'  ?'  N `/  )#N `+  ) Q N   T<'@@e: `2`  T#"@eҐ' %@eΐ #c " #\Ӫ x?'<%`  |w s ; `+  ;   :*`*`!(a.t *" *`$ ("(&` +`# +  " x) "@*   +&@+` "  ) "@*  ` ' -@ez`@e]`=$ $ $ x$ $ $  `' $ $ $ $ $$ ($ , ' ` K\~` ;\ "E7 @ ? `   `  `      %`%``` `Ė%` ```& ``2%``  Ǧ7✀` ` ᠐@e% N /q6@e&C&#aԀCaԁ 㿈#\9;x"a`"`3bg- $\@<<  @\\``.#p >$#d 6x#h$@b#` #laIJ"$ |1/`$' ```" "`@ 6 9`"g/`"Z@? : @`` `& `[ *` $J  ``# "  6? ` `;bg* &Y@? 9  `` ``&#`[@ `' @dPl  6 "@dE @d@d8 h.   dFp\`#pp㿠!'x!ĺ!Ĵ  !Ģ !Ě# "@  @3x+cbh`QQ `@cϒ ```$! `@` ```%@% @Pb-1/6%x#Ь`  %g* "@X@@88`#@`` "g+`& Z @: :%` "g+`& \@@:<` @`$%  &@ `# Z @@c ```""`@ ?` ``""`Q3bPΒ?􀤀x+c"X`@cH` xag) "X@@> 8`%)x!% x-ag-&]@@; =`"x`  $ "Z $`̬?􀤀xc``@c ``&%@`̒GՁ㿠;9a75x1x-x`+cPq O#`&` | "%Pd h@b㿠;b`#xabg+$Z@ @::`!9x%x9x"7 )" &@%]@'$@PD㿠;b !x'!g,$@]@@: =` `;x`a`. %%$b  /?  %? @b+` `% &9 "5". "@bqH`/"`@bc J( J`/@bw%`*㿠; b&  &㿠     @bU    `  @b# 5o   ` @i&  PP PK  c$  I!Ԁa   &   ?&   & $ @aې .   `@b    ,&.`@a $@aה&@aϔ@a&  㿠7 ``3 \ `9 "@a'+bP# `$   `@a{`Ӑ"  ` 㿠;9a"`@"$`& +a  & ?㿠3bbb'` x";aaĄ @&`@-x`&-x#aaĨ`$$@  D?' & "; ``"6 * " *``6+ ,`%,@ 2! @/-O[ O7 @"`-`&&? & 㿠  ` @`    @`㿠;1b!b;bb@`G `@`&&TT`@`Ӑ㿠EXV?T ;P?bb!( < (    ɐ& A׀ )Ð& A l  < > ?& A!0& A!O! !"!5!& A!f& A!b !O!RHx!S";x& A!h& Ab9!Ġ!!Ĭ&%` !ĩ4`<`   @``& '``&"%ĦIJ`%&5`@= @ "  "' !x&%@"# "@    x""@ !  @`#&m#aĺ &&db"]$2耥@= @耠@ +`# +  ` @- %@,  &*`' ) ``, $@/` @.`%-פ &`8 `3+ #@ * (,'+ `#@ ,*@ #? * ` (`%`/ %,'`&|Z.` @.@(@ ? 3 A^w J ;;?@^w@^ @А  $"@  Ę`&&S9x#$O.&@-L @CL@"4 9 '""+'"'`"&`( && X% %%b b$b   51)@^W!+5/c\"$Fx3b ` b& x9"%" ⬮ `$````  `"'`6"@^]4x"aL\ % ")/  bg( Z@>:%@% *$@ ``%   %L3/7Ēx"`⬈&Ă&@⬬" 7x9;!Ĵb!Ēb$ "  @&!!Ĩ`$$ 'b⠀`x-g/`%\@= <#@x3xxa# aĐ ! ^S5&P } b%+)b }%"}#"JK l⤀9"@5@xa"Jߐ  xc"X@]\  ' g- %@[@; ;"/ /⠀  g) "X@@>8`&@5 5/"`#"b7x%$[ ƻ c`@]%  Jx` 9x3c"``@] 2`  bg+$@Z@ @::`!' '⠀ 7 g/  @]@>=%@ aĒ  " '@ "Z % x     R%!@\#b   $"  1-"@\;b ԝ㿠;9aԪ!Ԭ=`/zx&`?%x0Q @\ @ɐ Ht$|,ddd㿠. 3'bط.? 'ؘ`,`ŀ ? ?J   $ ? ?&?? 3 ??$??&  ?"[ ?` @\3"` ? ?ג : `@\&  ? d" d ` ???$ ???%`???%``??? ``???!  "? "` ?? #㿠  ``㿠9##@ ) @[`& + m,$&`";ZaԺ.%㿠7`  @&,& 㿠9##'`   &%&`& 㿠 9x 9x5""ĸc c&% \   ` `! X'  #`a   `&^@>.  `a  $#[ :` @ .1   ` `"  a"`@ : &@ @:  . X " ` %= &@& .  `##`Z '    1 `  $## '  `"  ! X `>`@.#  `` &%^<.  %'  㿠xb!Ħ $$`#c b!c  `&@%`]  `   `_@'& ``"  "`@ : & ':  .; _@ "& x !`# "cX :  . `!`c ! Z [ @ -"# x ba! c" "`X @ x !Ė " "`aX:   . "!a` # YZ " c`  ## #?##`  ?""  a` ᰔ# "ᰁ 㿠;cc/ @  @`<*  @@ (@  0@ @ `I&- #a"- %  #a  #a  #a  #a 㿐;9aĒ`FӐ !  Eu7Ā  Fƒ 3 a Eg㿠;cc/`` 3 1a-@ ,+`+  ` &!  (@` (=. $<  Ș[@ "$!  (@ `(.`$; aȖ[ " "az 㿠;9c#'`3c &c 㿠3xcb?;a;c& aĀ+  %$\@:  .3   " ! X?`@./  `$   ` $$[:  .;  " ! X_@$  㿠  /  -` /   ``,  "! !!A ""c 7;aРᬺȸc  ? 2'`?? . `$ ? `(2`?@ %`;. ``[  '` @Ӥ  㿠9 '!57&`8!3ȶaР   2(  -`"  `'`@`(2 $;  .   Z  ' Ң` _ 㿠 9O`9 !ؐ  ? N`E  H?@W W@W 㿠;9aג!̒# cG 73/ᬶaȸТc  `24@  -H"'@`-`` '`@ (2  `#`:  .  Z &`Ʀ G 㿠;b`9#7-6.`@Wd܀@< 㿠;b`?9'# i  㿠;a <;c5-V27c4 &+ *`@W " &@.`@ @W@` & &`&  㿠;a  ?`@ ?.?'`?@! @Vؔ  @& ?-!#4`'?%%?,` @-` @V #! #`## #`## #`## #`## 㿠 9O``9T"7 ? Ә  V J `@VZ M?@VO @VK  㿠;%b434c  7@V4;'c 㿠k;x b@;x9cb@V C  V  㿠;9xQb85;x7cb 1/"-@U:5DO"`0@Uސ '6@Vϐ3x@Vʐ3xb+x)cb@U :5j㿘;'cc/`` ? Ѐ  5' "xB -* b| "  ,   ` ,B  Ѐ "  +.4b؁  㿘;'c?c/  @?Ѐ` b  ? *`I ?b +     `? ,` h? - ?? .  h c, x)' ' ' ''|'Ѐ '#'# '' ''''N `"ː  $'̀4'̴ ?'̀ В '̖ז  ̀   -+a% @U- ^891D'#L;,cX'Р 'ȘВ 'm 8   ̺c '` c~* `    / 4@&``4.`3`` @ N`@T ``   @'̙+` 2`` @T1&! 㿠;a 2-`.3c`L ǒ,:  Lxլ >  ՞ 7 &ἁ @o㿠 P;A֒ `|x b%  㿠;b=@  㿠;b`3?`1~ k7{ ⬀9 r ?㿠 9O``9~ 7Y̒ ? r S J `~O!?չ@S      i  d㿠;cc/ @' @#N `#~  y a /?{@S ` ?  ?+   ?KSTJ `Eyђ)%S'-z}?F@S A’ @Sv7~U$ǐ   $,@Sf?. ǘ 㿠;z 'c;a5()!XԄ- + %c3/##(`@Kxy`*`b `+@ x `,@Ր? /`/ '`@`&,& 㿠;cc/``Y+@ ?P)!'3,@  5z&-@ `(( *`ԅ? &"aԔ ,``& &,& @㿠 5O` 5}m/Ӓ$- 8 ? M` / @  3@Rm 9##`@RcM``&`@RZ&` 㿠;9b<;bT'!  z"c) `  #!c#+ 3%3tbx/{-+,c$)֘ !B @~*  {|_@R 㿠?|ې `  N 3c1#  - 9  ! ;a @Qѐ㿘;'c?c.@   ? (  ? / , @Q |i  .* * ? * @Q  ? ) ? - @@@Q N` u@Q ?Ѐ 硐'??? 3*`,? (@b+ה?!? ,` ? +` ݒ ? - 5  9!@Q/㿠C 㿘  'O`` {&!_"ܒ ?x @ P J `9' 0')"m) 墐  +c~ /31br#@Pڐ 9x7c"8@Pɒ  2   㿠;cc/`` @؁Ѐ Ж ߘ   .֘  6 @" 㿠;cc/`` @Ѐ  Ж 帘   .寘  4 6 @ 㿠 5O`5{MP 3c( ? ʘ  P  J @PQ9{0#<C @PG`" 㿈;1c;c| ?IJ ?'?!'''5   ``@` @ x/xb-c+')&`= h@P cT#Z җ #   *@   X= Ѱ    ',`@  ) Вќ}& # a %$-`o/ x? 㿠    y%?e@O @O7;9#@O'c 㿘 'O`  za%'ƒ  ߘ 6 O# J /-`凐 &'Ք   d` /  3b 97"ڔ@OB4   㿠; 'a;x5xb3c1x/c-&+< h`'x@O "X#}@O l`r)}%"xc`$$b`@O   㿠;?'a;x5xb3c1x/c-&+"`=%/ ' ,$#3  :< x c"h @N +c   S :- 2 T: `2 H: +ܨbgx\@<< &+`# @ ;Ӓ"`@NY&x2` c"X @NK    :_&/c`͔ xภ `b`@N5 @ +;㿀;1ca;a3xaĺ -x  ; bh+@N )x'x;X@N:6a,"`@N a$#Z 9    + ::  /xa`&@%$\<   ` 99  ;M xX@M˒94xb`@MÒ !d 99Ԑ / [ 99ː ;)  x"X@M9ʐ<x`@M 4dp'|'''' ,``Ւ'ђ'9 (:  :` ?̐9 )Ð a3x/c+x)c :ؐ /bX@MW 9{ b` @MQ 쀤7x'`4ٔ :㿘;x9a"g'x# ^@>=%#\$: b(   ;^9x;c"h`!@M$!`~ \cP#`a"(, )< &    9 x `:x     ` @ ``` ` @  "  x;cX`@L̒`Y :`   xDx cb@L  ` xc"`ส` @L ` \ @ @(` x 8 x c"D @L:㿈;aĀ`7NԀ  9 5x3c`h%x@Lx  #c9 `X!@Lo 8"xc`` @Lf  ! 88v / 8y8l % %9ƒ x c bX@LC 8fbxc`@L: 쀠` ٖ 8V і 8N'8L8?  ;7x9 1cX/ -x@L 8= +c``@L 耥   8.  8&98$"(8 9*`2<b   `  - ` -H -*  r*  - w* @ S s -2 x*   - r*  - w*  S s -2 x*  - r*  - w*  T t -2 x* * 㿘 ' ' ?/@'<E  v ? 㿘 ' ' ?/@'<E  vɖ ? 㿘-```5x 8 `` (R` xc"h@K4 `` /`89x!.u`` , @@K`܀ ` `` . @ ` /(`` .`36 ` ` (V @Kb`` - [ / `` , @`z  / `` *`  `` +``@K ` ` *   @K  6 @J `6` -  @Jߐ @JȐ5z6#\\@@>   <`%, %@- +$@ @JÒcx!`` "') av `` .@ `8` ` @'*@w ᰀ -/ >/%'.u1``` /`-pޒ-@uЖ @Jf@Jb7㿠;xb9x7c53'`/}7Ɛ "h@JE ,bD1}"77ā㿠 x"9"!&&^@Đ% >  "   & > . [@&  > ` `" " x9 !᠅>/5 _`%8 ``$ $`@ > $ %> .- ]&`73`&<b(   8 )%"8 <7I$5;+b8b<7Ax a!: ! . !"" ᨀ6` " ! 6 ``" a6㿘.`^ `` *5ax 5x#c``/x@I E8>j ` `9xb(!:'. ) t ! -  `t<`      1" L/`<' `I */ ` 'x `` 'x /, 'x` " 'x=  .+ %`'@ ' U  @ P ``  6%c T@H4\m <`!@ 6#(`@H ` `@Iؐ  `@Iא 6 0 @HӘ 6<`@H˔@H  %6Dbh@H`"@ @H` z!6#\L ] @: = ".  (-`%@H`4 0@Hp` 6@H#h /  ` )Ȑ` /``/"`  ` (a`S`  $ 6s #x!cbX @H7 @H<` 6` 4F ` -xD+x)cb@H!  ;x1x/c"`@H ;xa>.3 &`㿘/x-;cĨ`  `$#` 7x h`  5m`@G`" ! `7xa>.7 `+x-/&`5K3 bX@GȒt@Gɠ☰ !xJ "`%}@G;} 'b``$?`9"   ᠬ ```" "Z   @Gؐ `  76 @GŒp ) )#`? `4 `᠈ %%X@   3}( 5`$#`Z  +}}   b8 b<%b耧ޮ㿠`;Fcx3b+aa`" "Z 8> 9 baa`&%\. !&\?5}9-+}T  &"8&<%b,`&+㿠5`>:&}$v8{܀ +Lb  ;}􀥠;} ;};} .b9}"44㿐;a؀ a ? @F-'U 5R  `aR`! 2%&E.@B*`+a 8`  5`$1   .*` !`9`?$  `$??" ` .` -{ ` !  .@.@&"0z?$!#}$3}"8 $bb<#? "} 1x9c"8  @F 5x+)'"`3u  bJ"'D'b?b'";'   , / 5n"    xcX7x@EŒ  $"@'x* xc``@E %%@ $@+xx#`$b% $`'`  !/x-c8@E 1_&!؁㿠;cc@>` @=`- &pI,&㽐#\-(`  x5x"Dc@Ee"! 3} %}1 a#&b$ #` #cM`/2'- )5͒?)"`Jغ 1 &# #a5d/ %׭\O  \ "#,#p ad+a$ j` vj`#c` uX)#4    N `.tJC@D @E% `@   @ )Eo? *! ?  - 0? (`.? ,`ss ? +` @D `$ uE i5e!#`9<;Tc? `c6#  !x+)c7#@D͔ #x%c"@'-b@Dz$.?31"$ e&c)= / c4a#`!ᠠ̬ +0 b4 "09}}'"4 )}7}"11?  ?؀`  #aπV` V  !V`.  *`  > >.@+`   `yc5;`Kc ? ἴ;( ' #`+  ' +  @@C&  ` )   @C  %&*%b*Ѐ&`"1!`%x!쀠e (th   ,"aؒ XyҐ}+ "` "> Ѐ``> 6> ;xa쀠`@ `  <  ".(.+    a ᜀ%# ` ʀ` ` 9'!`"o;?1"`/ 0\2. #\ /`&7+ c-@B\ c* @B\ !##&c,@B\`c c  @Bȸ !``  ""㻘; c &в`&؀`&&&&&&&&&& &&&6@Bct-+za!\@:  < $@*# +` *$& !& k mbB3g M/1.`k@Bo@BgG0ɒ`f2`.`O`@/` k X \6@BJx`k@BA `? x!@B7`, /`;`/"``@B*@B!k{`#6@BRc|0u2 @BO'6@B〺 )6@B8#`@A&kk ê?@Ad؀2 `/6@A֒@AӒ㈺` @A`9x@A"&/,/7㿠㿠%02d-%02d-%02d %02d:%02d:%02d%-*.*s%-*.*s%s, line %d: %s %s TERMr%s: Not found %s%ldPATH=/dev/tty /dev/tty%d%02d%03d%c%cTERMw+[%dm[%dm[%dm[%dm[%dm%d%d%ld%ld: parameter null or not set FD"$\`?*["$\`FAT FAT12 FAT16 \/:*?"<>|\/:*?"<>|+,;=[] . .%d .COMLPT/...///.PWD.?-@FD_ /.//bin/rmrmr..../%02d-%02d-%02d%02d:%02d:%02d%02d-%02d-%02d%02d:%02d:%02d !"#$&'()*;<=>?[\]`|"$\`PATH: : launch (Arch)arch "bind "setdrv" keymap aliasfunction() { }: : rw &;()<>|: Event not found. Cfd-unicd.tblfd-unicd.tblemacsviwordstar"$\` &;()<>|&;(`| !"#$&'()*;<=>?[\]`| !"#$&'()*;<=>?[\]`| !"#$&'()*;<=>?[\]`|"$\`: %*s%*sF%-6dAlt-%c %-7.7s%-7.7s%-7.7s%-7.7s%-7.7sCtrl-%c '%c' Distributed by: %s %-7.7s/dev/:\/etc/mnttabr/etc/mnttabr4.34.2ufsffsext2jfsefssysvdg/uxpcdos7fat32.%-20.20s %sTRANS.TBL;%d-%d;%d-%d JanFebMarAprMayJunJulAugSepOctNovDecr....L%dr/.+--...%-*.*s/./bin/sh %2d %3u, %3u %8ld %02d-%02d-%02d %02d:%02d %*.*s %*.*s %*u,%*u %*ld %*.*s %02d-%02d-%02d %2d:%02d:%02d.../.....00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t00000000000000 Ք ՠ9  oPoNoOOHX ooې@@(#)fd.c 1.03u 12/18/012  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~APA PAlP $0<H*+,-./0123456789=   H$I,J4K8L<M@NDOHPLQPRTS\TdUlVtW|XYZ[\]^_`abcdefghijkabefnrtv  <L\l ")`)p*,/@02<4d6; $?0A8A@AD000000000000000000000000000000022222222222222222222222222222222 p@OTJ YZX@\#ca@@\#ca@ @ UT[@ JT TUXYZ[\@#ca@\@#ca@ !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_``abcdefghijklmnopqrstuvwxyz{|}~!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  0123456789abcdefKJIHhbOSRW kjlhxDgG0$ohHIJKbORSMW !!!!!!!!!!!!""" "$<$D// $L$T//$\$d//$x$//$$//$$$$$%%%%8%P%\%t%%%'` 'l'' '((0(<(\(t(( (())@ )L)l ) )))2**(*T2*`**2**+ 2+4+`+|++ +,,(,X ,d,,(,, ---$-H -------. .X.d.h...//$/4/`n///n///o///r\/00s0 0(0<t00H0T0ht0x00u 000u\000u111$v|141@1P7v1`1l1|7v1117v1117wD112x22 24z2@2L2\|L2h2x2222X222xH222h333$0$3,383L03\3h3|t333h\333N(333444(24<4H4XH4d4p4|H 444Hp444H444H455h,55(58h5D5P5d?5p5|588555H555n@556X66 6,H686D6P@6\6h6tX666X666n666N77 7N7,787H^7X7d7tN777 77764788(L8 808@&~(8P8\8py4888888|888$999$T949D9T6t9`9l9x899909990RS     "$&(*!#%')+ 7JK ;<>1 2 3 5 () +-*5][?:ab'cde(f$h#ik!l\mp+q;r s"t&u*v)w%xC-DF0H3L,M.Q;S1T2U/hbOk:6 98=@@@@@@AA AAdbclsp@` @/@=|nobu@psrc.isac.co.jp FD(File & Directory tool) Ver. (c)1995-2001 T.Shirai ޥɤλȤ㤤ޤ.Illegal function call../etc/fdrc~/.fdrc򲡤Ʋ.Hit any key.~/.fd_history[%i%d;%dr[?1h=[?1l>[?25h[?25h[?25l78[%d;%dH  [%dA[%dB[%dC[%dDOAOBOCOD[4~[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOTOUOVOWOXOYOjOkOlOmOnOoOpOqOrOsOtOuOvOwOxOyOXOM[2~[5~[6~[9~[1~[%d;%dRunknownNo TERMCAP is preparedpcbcupkukdkrklcolixnxstitemmmocskskevevsviscrcblvbclmemdmrmhmbsousseuecealdlicICdcDCscrccmhocrnlsfsrupUPdoDOndRIleLEUPDORILEkukdkrklkhkbl1l2l3l4l5l6l7l8l9laF1F2F3F4F5F6F7F8F9FAk1k2k3k4k5k6k7k8k9k;k0kLkAkDkIkCkEkPkN@8@1@7Column size too smallLine size too small?**.PATHPATH.HOME/dev/rfd0c/dev/rfd0c/dev/rfd0cCON AUX PRN CLOCK$ CONFIG$ NUL BATCOMEXEPWD=PWD򲡤Ʋ.Hit any key.򲡤Ʋ.Hit any key.ȥǥ쥯ȥ򼺤äΤǺǤޤ.Working directory is lost, to abandon works.ȥǥ쥯ȥ򼺤äΤǺǤƥۡǥ쥯ȥ˰ưޤ.Current directory is lost, to abandon works and move the home directory.ȥǥ쥯ȥ򼺤äΤǺǤƥ롼ȥǥ쥯ȥ˰ưޤ.Current directory is lost, to abandon works and move the root directory./ǥ򴹤Ѥ鲿򲡤Ʋ.If new disk is ready, hit any key.ԡζ̤­Ƥޤ. ǥ򴹤ޤNo space left on destination device. Do you change another disk?.-rfȥǥ쥯ȥϽߤǤޤ.Current directory unwritable......] Ʊ̾Υե뤬ޤ.] The same named file exists.U: դUpdateR: ̾ѤRenameO: ƾOverwriteN: Ʊ̾ϥԡʤNot_copy_the_same_name̾:New name:] եΥ¤Ƥޤޤ ?] The file is restricted on permission, delete really ?Y: ϤYesN: NoA: ƺAllK: ¸Keep_allե뤬Ĥޤ. ȥǥ쥯ȥѹޤ ?File found. Change current directory ?ե뤬Ĥޤ. ȥǥ쥯ȥѹޤ ?File found. Change current directory ?OldNew⡼:File mode::Date::Time:ԡΥǥ쥯ȥ̾:Directory to copy:եΥԡλޤ. 򲡤Ʋ.Copy finished. Hit any key.եΥԡλޤ. 򲡤Ʋ.Copy finished. Hit any key.ưΥǥ쥯ȥ̾:Directory to move:եΰưλޤ. 򲡤Ʋ.Move finished. Hit any key.DOWNUPLEFTRIGHTHOMEBSASTERPLUSCOMMAMINUSDOTSLASHTK0TK1TK2TK3TK4TK5TK6TK7TK8TK9EQUALRETESCTABSPACEDELLININSLINDELINSEICCLREOSEOLESFESRNPAGEPPAGESTABCTABCATABENTERSRSTRSTPRINTLLA1A3B2C1C3BTABBEGCANCCLOSECOMMCOPYCREATENDEXITFINDHELP PATH=PATHToo few or many argumentsOut of limitsNo such entrySyntax errorEntry already existsInvalid devicelauncharchprintlaunchprintarchbindprintbindsetdrvunsetdrvprintdrvkeymapgetkeyhistoryprintenvaliasunaliasfunctionexportchdircdsource򲡤Ʋ.Hit any key.򲡤Ʋ.Hit any key.򲡤Ʋ.Hit key.(Space ǽλޤ.)(Terminate with Space.) "" Υޥɤϻ¤Ƥޤ.This command is restricted.ޥɤλȤ㤤ޤ.Illegal function call.ޥɤλȤ㤤ޤ.Illegal function call.ޥɤλȤ㤤ޤ.Illegal function call.򲡤Ʋ.Hit any key.ʸСեޤ.Input length overflow. &;()<>|HEXhexCAPcapSJISsjisEUCeucUJISujisJISjisENGengfd-unicd.tblfd-unicd.tblǥˤȤߤޤ.Interrupted by keyboard. There are possibilities. Do you really wish to see them all? (y or n) ˶ʸޤޤ ?Delete space characters on the end of line ?[Y/N] HomeEndDelLinInsLinDelInsBegEolPageDnPageUpClrEnterBsTabRetEscUpDownRightLeft򲡤Ʋ.Hit any key. : 򲡤Ʋ.Hit any key.dos7pcfat32roե륷ƥFile systemޥȥݥMount pointFSFS typeǥTotal disk amountKbytesѥǥUsed disk amountKbytesѲǽǥAvailable amountKbytesХȿ/֥åBytes/blockbytesiΡɺMax i nodesfiles򲡤Ʋ.Hit any key.rrrTRANS.TBLrrr*.lzhlha l*.tartar tvf*.tar.Zzcat %C | tar tvf -*.tar.gzgzip -cd %C | tar tvf -*.tar.bz2bzip2 -cd %C | tar tvf -*.lzhlha aq %C %TAlha xq %C %TA*.tartar cf %C %Ttar xf %C %TA*.tar.Ztar cf %X %T; compress %Xzcat %C | tar xf - %TA*.tar.gztar cf %X %T; gzip %Xgzip -cd %C | tar xf - %TA*.tar.bz2tar cf %X %T; bzip2 %Xbzip2 -cd %C | tar xf - %TA:Arch:..ե뤬ޤNo Files ˤŸ˼Ԥޤ.Failed to unpack.򲡤Ʋ.Hit any key.ŸΥǥ쥯ȥ̾:Directory to unpack:򲡤Ʋ.Hit any key.tar cf %C %TAtar rf %C %TAե븡:Searching:[No Files]/..... Tree=.ѹǥ쥯ȥ̾:New current directory:/FD_SORTTYPE֥饦̤ΥǥեȤΥȥפꤷޤ.Set the default sort type in browsing mode.FD_DISPLAYMODEưΥե̾ɽꤷޤ.Set the default display mode at the start.FD_SORTTREEĥ꡼ɽ̤ǥȤޤ.Do sort in tree mode.FD_WRITEFSǥ쥯ȥߵǽλѤػߤޤ.Inhibit the function to write directory entries.FD_ADJTTYλü⡼ɤŪ˥ꥻåȤޤ.Adjust the termical mode when exiting.FD_COLUMNSưβɽꤷޤ.Set the default columns in 1 line.FD_MINFILENAMEե̾ɽΰκǾʸꤷޤ.Set the minumum columns of filename field.FD_HISTSIZEޥξ¤ꤷޤ.Define the maximum size of command history.FD_DIRHISTǥ쥯ȥξ¤ꤷޤ.Define the maximum size of directory history.FD_SAVEHISTޥΥ֥ե¸ꤷޤ.Define the maximum size of saved history.FD_DIRCOUNTLIMITĥ꡼ɽ̤ɽեꤷޤ.Define the limit of displayed files, on tree mode.FD_DOSDRIVEեåԡɥ饤ֵǽͭˤޤ.Make MS-DOS floppy drive function effective.FD_SECONDȥԤλפÿˤɽޤ.Display the second hand of clock at title line.FD_SIZEINFOե륵Ԥɽޤ.Display the filesize information line.FD_ANSICOLORեɽ򥫥顼ޤ.Display with the ANSI color escape sequence.FD_EDITMODEemacsϻԽ⡼ɤꤷޤ.Select the edit mode with your favorite editor type.FD_TMPDIR/tmpŪȥǥ쥯ȥꤷޤ.Define the temporary directory.FD_RRPATH RockRidge ĥǽȤǥ쥯ȥꤷޤ.Define the directories of RockRidge formated CD-ROM.FD_PROMPTsh#ޥϻΥץץʸꤷޤ.Define the prompt strings on command line.FD_LANGUAGEɽʸδɤޤϸꤷޤ.Set the language code to display.FD_INPUTKCODEܡʸδɤꤷޤ.Set the language code to input.CUR_UPCursor upCUR_DOWN򲼤Cursor downCUR_RIGHT򱦤Cursor rightCUR_LEFT򺸤Cursor leftROLL_UPɽڡNext pageROLL_DOWNɽڡPrevious pageCUR_TOPƬCursor topCUR_BOTTOMǸCursor bottomFNAME_RIGHTFILE̾򱦥եRight-shift nameFNAME_LEFTFILE̾򺸥եLeft-shift nameONE_COLUMNɽ1Into 1 columnTWO_COLUMNSɽ2Into 2 columnsTHREE_COLUMNSɽ3Into 3 columnsFIVE_COLUMNSɽ5Into 5 columnsMARK_FILEFILEΥޡMark fileMARK_FILE2ޡƲưMark & downMARK_ALLFILE˥ޡMark allMARK_REVERSEޡȿžMark reversedIN_DIRDIR˰ưTo sub dirOUT_DIRDIR˰ưTo parent dirLOG_TOP롼ȤؤΰưTo root dirREREAD_DIRɽ̤κRewritePUSH_FILEFILE򥹥åFile to stackPOP_FILEåFile from stackLOG_DIRDIRΰưChange dirATTR_FILE°ѹAttribute changeEXECUTE_FILEFILEμ¹Execute fileINFO_FILESYSFILEƥFilesystem info.COPY_FILEFILEΥԡCopy fileMOVE_FILEFILEΰưMove fileDELETE_FILEFILEκDelete fileDELETE_DIRDIRκDelete dirRENAME_FILEFILE̾ѹRename fileMAKE_DIRDIRκMake dirSORT_DIRFILE¤ؤSort filesEXECUTE_SHҥץμ¹Execute shFIND_FILEFILEθɽFind filesWRITE_DIRɽDIRνWrite dirTREE_DIRDIRTREEɽTree screenBACKUP_TAPEơפBACKUPBackup on tapeEDIT_FILEFILEԽEdit fileVIEW_FILEFILEαView fileUNPACK_FILEFILEοĹUnpack filePACK_FILEFILEΰPack fileLOG_TREETREEǤDIRưChdir on treeCOPY_TREETREEΥԡCopy on treeMOVE_TREETREEΰưMove on treeUNPACK_TREETREEοĹUnpack on treeFIND_DIRDIRθưFind recursivelySYMLINK_MODESYMLINKɽSym-link statusFILETYPE_MODEFILETYPEܥFile type symbolDOTFILE_MODEDOTFILEɽHidden dot fileFILEFLG_MODEFILEFLAGSɽShow file flagsMARK_FINDFILE˥ޡMark selectedMARK_FILE3ޡƲưMark & downLAUNCH_FILEεưLauncherSEARCH_FORWFILE̾Search forwardSEARCH_BACKFILE̾θSearch backwardHELP_MESSAGEHELP̤ɽShow helpQUIT_SYSTEMFDνλQuit FDWARNING_BELLٹ٥WarningNO_OPERATION⤷ʤNo operation..*ե̾:Filename to find:ѹǥ쥯ȥ̾:New current directory:/FD_SHELL`exit' FD ޤ.do `exit' to return FD.FD_PAGERmore%KFD_EDITORviN: ̾N: fileNameE: ĥE: ExtensionS: S: SizeT: սT: TimestampL: ĹL: LengthX: ʤX: No chgU: U: UpD: ߤD: Down.ȥǥ쥯ȥϽߤǤޤ.Current directory unwritable.ɽǥ쥯ȥǥ˽ߤޤ ?Write this displayed directory on disk ?ߤΥǥ쥯ȥ¾Υ桼ѤƤʤȤǧޤ ?Are you the only user on this directory, now ?FD λޤ ?Quit from FD ?~/.fd_historyǥ쥯ȥ̾:New directory name:̾:New name:ְ̾äƤޤ.Illegal filename...ޡեޤ. Ǥ ?Deleting the marked files, OK ?[%s] ޤ. Ǥ ?Deleting the file [%s], OK ?[%s] ǥ쥯ȥޤ. Ǥ ?Deleting the directory [%s], OK ?ե̾:Filename to find:*Ƶե̾:Filename to find recursively:.ΥեϸĤޤǤ. 򲡤Ʋ.File not found. Hit any key.˥ե̾:Archive file:Τꤿǥ쥯ȥ̾:Target directory:.A: ե⡼ɤѹA: AttributeS: ,֤ѹS: timeStampޡեѹԤʤޤ.Changing attr. of the marked files.ܥå󥯤°ѹǤޤ.Cannot chenge attribute of symbolic link.ॹפ꤬㤤ޤ.Invalid timestamp.ơפΥǥХ̾:Device name of tape:/dev/I-:I-search:I-:I-search backward:LogdireXecCopyDeleteRenameSortFindTreeEditorUnpackPath:Page:Mark:Sort:N: ̾N: fileNameE: ĥE: ExtensionS: S: SizeT: սT: TimestampL: ĹL: LengthU: U: UpD: ߤD: DownX: ʤX: No chgFind:Size:.Total: KBFree: KBФ餯Ԥ.Wait a minute.OVERFLOWե뤬ޤNo FilesNoFiles..I-:I-search:I-():Failing I-search:I-:I-search backward:I-():Failing I-search backward:....ե뤬ޤNo Filesǥ쥯ȥꥹå˴ƤǤ ?Directory stack will be broken, OK ?.ɽǥ쥯ȥǥ˽ߤޤ ?Write this displayed directory on disk ?Υޥɤϻ¤Ƥޤ.This command is restricted.//9NOHOTOT Ք ՠ լ հ یېx@D`m, /BP\D`expլ D`լ V@d V V V V W W( W< WP Wd  Wx +W 4W =W FW PW ZW dX nXd tX| ~\4 ` bL c(p c8 Ddլ DXp  l qP u 'v -|<t 6| ?}` J~t THh _D i< tD`լ  pl  | h lT X H %H 2 > F ]@$ lt@ w8 $ 8@ G$լ 48<@DHLPT `'I 2J <J,FJMK, XKLaQPjR,rUhyd $  l $   l  X d  0 P L<   H P ' 0 : E$ O4 Y d< l| u <    X  8@  x x\ @ $h 4 L ,L x     # . P 9 p D!T O"Hp X"x b&0 n+h {3| + , - 8( 9  ; = =  G Y( [  e VT xլ 'x18D`ALլ [dm~ x|x 4 D`լ x ((  l 4   D`լ "+4<FPZH d o| z0 4l ȠX T Lp ̼  Ϥ\  H X`լ     #p , 6D` ? Jլ Y g s  } | p P " )` )p *| , /@ 0P 2< 4d8 6T ;  ?0 AX #Ah . , ; 0l B M&T  W9h e mD` v լ  G H4 I R|  T \ Y c,P  D`  լ   # .z` 8 C N YZ d p y m n z$ { } @(  Xh  լ @ < L \ l p t x "| ,D 4P 9\ >XD H0 T0 _0 h,0 s\ {   `  P @ @   P ` t T   l X (PX 9 Ip YT c l u(  Xp  լ @ @  h 4`    D` լ  &-X 8@ El\ R  _iD`r}լ   x 0T    `t ,  L -D D` լ %-4>EMT?` \C\ eIl oL xP@p S<4 QX Sp` U Vx WD Yd Yt Z(0 bX D`լ iD /jd 8BD`KVլ en\ ln uo r\4 s t0 t, u < u\0 u v| v v v wD x@  z |L !T (8 0Hd 8< C$  M0 Vt ^\@ h( u    d p   ,  h  8  @< ,  , @ h ) 3 = IP R _ m4 zL ~(p y4T ( | $ T  tp $  m vx  }p `    *3D`< Gլ V_ j,t0}4  0 L  h  X  p   0 TD , $h,L6p<4 ?`` H O8D V`ݬg q< y p 0 `"  _L  L`  DUT\  , | ,0gP 9Bz< JP U(\djܤr 8 \IX [$ X 4p |( t\ $ \  T _*ی@p JR0 R^DYut b jT s8zq\$ t<0h xt H 4, p 70 4  $ /$ (4 'hl .gP 8`$EQ \j s{m   Pwx` J, `L T ߌ |$m( ޜ ܘ0 & -8 ? Kh X fP r|h (pp, ݔM@ <@ $H P  T}, $ #lx ,X 3 ;8x B<J$ T[fr |y  e , lT0 8 l mL w` 0 ִ  x  d( P &@ 1s4 8@La( !Sd `$ov Xe(l    xՠ  f     # (-z@ 5(h >e(ENL Wcjm r~D x\ l8F (l p t d` \}( (P 3t !8'3m(L ;, DD O  ZbJ nt<4 |{8 0 }h( ݠk X rh4 $4  e$L %P +8 3d;5x DݸKRa( Zo ci| w\   ih  <L ) ܰy      ߤې4 ;r Ec@Ku@` So D X!` mtz  { p,  ܀߰e|@ l ]p $X $t< $P a  K  ިf@l & 0h >Xx`Jl, R  ^ h(sL zD^B4L  $ ބ] h  nd լ ,    o  'yt  .@ 4xp = Ex0  O [[ cp iB8 usH |L ސ D *lt  L {\4 8 0  m0| H ` P ! !T` !P !!!*0 !6c@!!;!D x !N !W!^AL !kc4!u!p!l4 !+h8 !!|!0 !d !Xx`!jTp !T  !,!|( !QT !\d " X"޴""+܌"2@":"E| "L"U"\"c"j "u, "}"!4\ "qh "48 "`"e"@ " "d " " "߀""O$ #,P ##| #! #+x#:$8 #B2d #M#U#^ #hU #nv #xq #{@ #0 #tXt #< ##|( ##` #bD #ht # #Rt ##}@( # $oP< $Z$L $#Bh $00 $;9 $Ew\ $M0 $T $]݈$e($oyd $u$}( $, $MX $ܼ$i 4 $$n@ $@$|`@ $x $0 $  $ZL $$%P% ۊ %d % % %&P %.4%5oL %?z4, %DiH %Iؠ %Stt %Z%cj$ %lH%u1 %|V8 %kT %+4 %x4 %s8 %%%%`l %%l%%%[T &d & D d & &%$&/oL &9nD@ &A&GD&NՔ  &T &r4 &|T & &ߘ&,4 &D &$&e&(x &&0&&L&`&zp8 &&&{$8 'L 'h'h' '%d '-m,'2} '8'Ae,'K|'S| 'Z'f] 'p 'xsl '''' 'h 'D 'p< '߼'',''ZlX 'o '8X (G ((x('L (3|  (;5t4 (Hp@T (N(W  (c|@ (l (w|8( ( (|(( (` ((,(((( ((| )mtD ) &L ))< )#jL )+nD )/X)6 )=t)C)J` )U)])dnD fdcrti.scrt1.s__get_exit_frame_monitor_ptr__do_exit_code_ptr__crt_scratchvalues-Xa.cBbss.bssDdata.dataDrodata.rodatamain.cBbss.bssDdata.dataDrodata.rodataversiontimersecsignalexitignore_alrmignore_winchignore_intignore_quithangupillerrortraperrorioerroremuerrorfloaterrorbuserrorsegerrorsyserrorpipeerrorterminatexcpuerrorxsizerrorwintrprinttimedoexecinitoptionevaloptionsetexecnamesetexecpathterm.cBbss.bssDdata.dataDrodata.rodatakeyseqtreettychangedtermflagskeyseqerr2ttymodedefaulttermmaxlocategetxytgetstr2tgetstr3tgetkeyseqnewkeyseqfreekeyseqcmpkeyseqsortkeyseqpathname.cBbss.bssDdata.dataDrodata.rodataskipdotfilewildsymbol1wildsymbol2uidlistmaxuidgidlistmaxgidgetvarsetvarcnvregexpcatpath_evalwildisexecutecompleteusercompletefilecompleteexeaddmeta___const_seg_900003101evalshellparamreplacevarinsertargevalvarevalhomedosdisk.cBbss.bssDdata.dataDrodata.rodatamaxdevmaxordermaxdosfmaxsectcachemaxcachememlfn_clustlfn_offsetdoserrnosectsizelistinhibitnamecachewritecachesizesectcachesectnocachedrivedosflistdevorderdevlistcurdirsectseekrealreadrealwritekillcacheflushcacheshiftcachecachecpyuniqcacheappendcacheinsertcacheoverwritecachesavecacheloadcachesectreadsectwriteavailfatreadfatwritefatgetfatofsreadtmpfatgetfatentputfatentclust2sectclust32newclustclustreadclustwriteclustexpandclustfree_readbpbreadbpbopendevclosedevchecksumlfnencodelfndecodetranschardetranscharsfntranscharcmpdospathgetdosnameputdosnamegetdosmodeputdosmodegetdostimeputdostimegetdriveparsepath_dosopendir_dosclosedirfinddirseekdentreaddent_dosreaddirsplitpathgetdentwritedentexpanddentcreatdentunlinklfndosfilbufdosflsbuftype2flagsdosemu.cBbss.bssDdata.dataDrodata.rodatapseudocwdlibc.cBbss.bssDdata.dataDrodata.rodatalastpathunixpath_realpath2_getenv2_putenv2file.cBbss.bssDdata.dataDrodata.rodatadosdrvcpfilechangemesk_strlenmaketmpfilegetentnumrestorefileapply.cBbss.bssDdata.dataDrodata.rodataattrmodeattrtimedestdirdestmtimedestatimedestdriveissamedirislowerdirgetdestdirgetdestpathcheckduplcheckrmvsafecopysafemovecpdirtouchdirshowattrgetdirtree_applydirparse.cBbss.bssDdata.dataDrodata.rodataescapecharescapevaluestrtkbrkgeteostrbuiltin.cBbss.bssDdata.dataDrodata.rodatabuiltinerrstrbuiltinlistsetlaunchsetarchprintlaunchprintarchsetkeybindprintbindsetdriveunsetdriveprintdrivesetkeymapkeytestprinthistprintenvsetaliasunaliassetuserfuncexportenvdochdirloadsourcebuiltinerrorhitkeygetcommand_setdrivecheckuserfuncshell.cBbss.bssDdata.dataDrodata.rodatahistbufsizesetargsetargsinsertargaddoptionsystem3evalaliasevalargsparsehistkanji.cBbss.bssDdata.dataDrodata.rodataunitblbufunitblentrsjistableconvtablesj2jtable1sj2jtable2j2sjtable1j2sjtable2hctypetableh2btableb2htablesj2jj2sjtoenglishtojis7fromjis7_kanjiconvinput.cBbss.bssDdata.dataDrodata.rodataemulatekeyemacskeyvikeywordstarkeyselectlisttmpfileposxposyposoverwritetrquotevlenrlenputcursorrightcursorleftcursorupcursordowncursorXlocatesetcursorrightcharleftcharinsertchardeletecharinsshiftdelshifttrunclinedisplaystrpreparestrinsertstrselectfilecompletestrdispprompt_inputstr_up_inputstr_down_inputstr_delete_inputstr_enter_inputstr_input_inputstrtruncstryesnomesselectmesinfo.cBbss.bssDdata.dataDrodata.rodatakeycodelistkeystrlistcode2strchecklinegetfsinfoinfo1linecalcKBrockridg.cBbss.bssDdata.dataDrodata.rodatarr_curtblrr_cwdgetorgnamereadtranstblfreetranstbl_detransfilearchive.cBbss.bssDdata.dataDrodata.rodatapusharchduplcountfieldgetfieldreadfileentdircmpdirmatchlenpseudodirreadarchivegenfullpathtree.cBbss.bssDdata.dataDrodata.rodataredrawtr_notr_linetr_toptr_bottomtr_scrtr_roottr_curevaldirmaketree_showtreeshowtreetreebarsearchtree_searchtreeexpandtreeexpandalltreeuptreedownfreetree_tree_search_tree_input_treecustom.cBbss.bssDdata.dataDrodata.rodataenvlist___const_seg_900000202_evalenvcommand.cBbss.bssDdata.dataDrodata.rodatacur_upcur_downcur_rightcur_leftroll_uproll_downcur_topcur_bottomfname_rightfname_leftone_columntwo_columnsthree_columnsfive_columnsmark_filemark_file2mark_allmark_reversein_dirout_dirlog_topreread_dirpush_filepop_filelog_dirattr_fileexecute_fileinfo_filesyscopy_filemove_filedelete_filedelete_dirrename_filemake_dirsort_direxecute_shfind_filewrite_dirtree_dirbackup_tapeedit_fileview_fileunpack_filepack_filecopy_treemove_treeunpack_treefind_dirsymlink_modefiletype_modedotfile_modefileflg_modemark_findmark_file3launch_filesearch_forwsearch_backhelp_messagequit_systemwarning_bellno_operationreplacefnamemarkcountprepareregexpexecenvexecshellbrowse.cBbss.bssDdata.dataDrodata.rodatamodelistsuffixlistcolorlistsearch_xsearch_ypathbarstatusbarstackbarsizebarputownerputgroupinfobarcalclocatesearchmovebrowsedircrtn.s_END__START_todayt_nometamodefinduidstrcpy2findfilel_cleart_reverseXopendirdosmkdirfgets2backuptcsetattrmemsetselectstrfindgidsorttypeprintlaunchcommdosintrfuncmarkend_standout_get_exit_frame_monitorstrcatdelimascnumericfunclistdoslseeksymlinkstrpbrkloadhistoryt_normalexecmacroprintkeymapdupdosfreadc_return_Xrmdirsafecpfileexecleend_underlinesprintfstrnpathcmp2copypolicycmdlinelenfreedosstatfstitlefindduplendtermXfread__fsr_init_valuestrcpyrenameregcmpsizeinfofinddirmoveposremovepolicygetinfofst_blinkmacrolist_GLOBAL_OFFSET_TABLE_ujis2sjisdosopenwinvarXsymlinkcmptreerealloc2calc_xXrewinddirclosedirc_insertcalc_ysetpwentforcecleandirgetgrgidevalpathssetscrollt_resetcursorisdelimXreaddirdosgetcwdfseekt_nokeypadstrtkchrpackforkputenv2getextdosfcloseuserfunclistcfgetospeeddefcolumnsfd_restrictedmktmpdirwritefsdosallcloseatexitgetargsc_scrollforw__majorunlinkXutimesdosstatrealpath2isdotdirfreadgettokenfdopenputvarfuncregexevalenvsyncgetlastpidfuncfclosegetwd2putch2fnamekcodeputch3displaymodestrcatdelim2transfilelistrewritetreetmpdosrestoret_highcursor_DYNAMICcc_intrXclosedirdistributortgetflagdosunlinkn_lineenviron2tmpdosduplatoi2gethomedirpreparedrvgetpwnamrename2inputattrhideclockdosfgetschdir2archbarchdir3t_vbellencodestrgetcwdlaunchlistc_scrollrevsearchdirXwritePCsetgrentrmvdirdosfgetccprintf2t_metamodestrrdelimraw2mktimeXchmodevalpathinruncomstripquotemarksizemain_fdn_lastcolumnqsortdecodestrevalpromptgettermentXchdirc_rightarchivelist_ctypegetblocksizet_normalcursorcc_eofkillmetasubwindowt_scrolldupn_linecc_eolgetmntentdosfilenosorttreeshowsecondgetrangestrrchr2tcflushputenvlastdrvorigpath_finidosfdopeninputstrc_leftt_endhelpindex_Xmkdirapplydirospeedsavehistdoschmodoutputkcodec_downmesconvkeywaitfuncstrchr2movefilegetgrnamt_bellrockridgepathcompletebuiltinwritewaitmesinittermlistupfilec_nleftregexp_initt_underlineXfgetcsafewritettyioprintaliaschmodtmpfilenamecooked2ungetch2kanjiconv2kanjifputsc_ndownevalcommandchdirmalloc2__cg92_usedXfopenstrncpygetkeyseqXfgetsmemcmpgetlangkeyidentlisthelpdiscardunitablelastdrivefreemacropreparedirgetvarfuncmaxuserfuncUPdosreadlinkadjttyyesnolostcwdstatvfsdoschdirselectc_home__ctypekeyflushwin_xprintarchcommgetenv2getpidwin_ycolumnscompleteuserfuncsearchhashc_nupgetpwentdossymlinkprintsetdrvchownstrncmpXreadrewritefiledestpathread_chdir2getkey2fgetc_PROCEDURE_LINKAGE_TABLE_cputs2unifysjis__iobXaccesstabsenvironcompletepathmemcpyXlseekfindcommonl_deletetgotormvfilehelpbarfopenc_newlinefgetsevalhistoryintrkeyloadruncomdeletedrvfdtypestrrdelim2insertdrvsavehistorydoslstatstrrchrdosfopensetkeyseqcompletealiassys_errlistwarningpoparchdupltotalsizeneedbavailkbhit2_edatac_locatedeftmpdircheckinternalgettimeofdayincludepathgetuiddoswriteioctlsetenv2fullpath_dospath_lib_versionlocaltimegetgrentblocksizesjis2ujissystem2Xcloseunamestrdelim__minortparamstrstrpathcmp2dosreadpopenexecbuiltinXgetwdsafemvfilelseekutimeslauncherusegetcursorskipspaceXrmdirtputsstrcasecmp2getarglistfuncdosfputst_boldtflushstrlenstable_standoutkillgetenvvalfreevarprogpathevalnumeric_iobvsprintfgetstatusevalwildhistnocheckbuiltinfilestackpathignorecasetgetentdosfputcdosopendirsignalpclosecalcwidthchgcolor_sys_errlistopentty_startdoswaitfuncXfwriteinputshellstrapplyfilet_standoutopendircheckundeffuncstrcatt_clearinputkcodeextcmpc_nrightn_argsaccessperroradjustpathevalifscloseprintmacroreadunitablekanjiprintfgetpwuiderrnotransfilewritablefslogical_accessminfilenamermtmpdirrmdirprognamedosrenamestrlen2n_columnstrlen3removetmp__environ_locksetattrdosreaddircc_quithistsizekanjiputserrorXreadlink_Xchdir_XfopenunderhomeXstatisexistinternal_statusXfflushstataddlistdosrmdirkanjiconvflushdrvinputshellloopttyoutXfputccopyfilenotabsarchivedirdosaccessexecinternalsearchpathsearcharcXunlinkgetch2fnameofstgetnumansicolorXopentypesymlistXfputsgetkeysymdosutimesopendosfwritegetretvalfuncecho2reallocXfeofevalargevalglobarrangedirsigvecresetreaddir_exitt_dim_etextmainmaxmacroXgetkeystrdup2mallocttyiomodeXduptree_evalpathXlstatexitfunconkanji1endpwentunpackdosclosedosfflushdosclosedirXrename_Xgetwdkctypetablegeteuidunitblpathputmode___Argvl_insertbindlistgetegidexecusercommevalcomstrexecpseudoshelltypelistlowercasestdiomodenoecho2fputcstrchr_init__1cG__CrunMdo_exit_code6F_v_tmpunpackstrncpy2strncpy3fwritelocateputnameuppercaseBCarchchdirfputst_setcursortcgetattrtgetstr__xargvXdup2findregexpc_upXmkdirtouchfilegetenvdup2stackdepthstrstr2_endstat2t_keypadaliaslistc_storemkdir2getflagfuncentryhistcmppathcnvunicodelcmdlinemaxlaunchhistoryisearchregexp_execshutdrv_Xopendirsystemlstatt_nocursorcurfilenamesigvecsetdospathprintfunctioncompleteinternalexitc_deleteregexp_freeXfdopendosrewinddirexit2endgrentdetransfilegetwsizetimelocal2Xfclosebackquotefuncdosdrivemaxaliaschgorder__xargceditmodereadlinkmaxarchivepromptstrdircountlimitcmplist_environkanjiputs2cbreak2copyarcfc_restoreinfofsinitttynl2strcmpcatvarmkdirfflushgetkeycodeseekdirt_initnonl2<J4*<J4 <N4 <M4 <L4<J4<J4 <K4 <K4 <M4 <K4 <K4 <K4<J4 <N4 <M4<J4 <L4 <M4 <L4cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)param.h 1.77 02/01/22 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)fcntl.h 1.15 01/07/29 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)tzfile.h 1.20 99/06/11 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)fcntl.h 1.15 01/07/29 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)signal.h 1.39 01/11/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)utsname.h 1.26 98/12/03 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)signal.h 1.39 01/11/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)mnttab.h 1.14 99/08/07 SMI@(#)statvfs.h 1.24 99/05/04 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)signal.h 1.39 01/11/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)signal.h 1.39 01/11/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)signal.h 1.39 01/11/07 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)types.h 1.75 04/01/06 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.33 03/09/17 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)file.h 1.65 03/10/14 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)mkdev.h 1.17 97/10/22 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12ld: Software Generation Utilities - Solaris Link Editors: 5.9-1.380.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.plt.dynamic.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstrmain.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o main.o -DDEFRUNCOM='"/etc/fdrc"' main.cmainterm.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o term.o term.cpathname.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o pathname.o pathname.cdosdisk.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o dosdisk.o dosdisk.cdosemu.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o dosemu.o dosemu.clibc.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o libc.o libc.cfile.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o file.o file.capply.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o apply.o apply.cparse.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o parse.o parse.cbuiltin.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o builtin.o builtin.cshell.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o shell.o shell.ckanji.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o kanji.o kanji.cinput.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o input.o input.cinfo.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o info.o info.crockridg.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o rockridg.o rockridg.carchive.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o archive.o archive.ctree.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o tree.o tree.ccustom.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o custom.o custom.ccommand.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o command.o command.cbrowse.cV=10.0;DBG_GEN=4.14.14;cd;backend;raw;Xa;O;R=Sun C 5.5 2003/03/12/work/pkgbuild/misc/fd/work/FD-1.03u; /opt/SUNWspro/prod/bin/cc -DFD='1' -DSOLARIS='1' -O -c -o browse.o browse.c  %`"99oNN`-BOHOH  8BOTOT` BBOO LTTRՔՔ Xՠՠ ^լլfհհoییtېې  yxx,@@6D`D`(D`F   )j jJ !!